KEGG   Rattus norvegicus (rat): 287249Help
Entry
287249            CDS       T01003                                 

Gene name
Cnot6, CCR4, RGD1310783
Definition
(RefSeq) CCR4-NOT transcription complex, subunit 6
  KO
K12603  CCR4-NOT transcription complex subunit 6 [EC:3.1.13.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    287249 (Cnot6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    287249 (Cnot6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     287249 (Cnot6)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     287249 (Cnot6)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     287249 (Cnot6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos LRR_8 LRR_4 LRR_6
Motif
Other DBs
NCBI-GeneID: 287249
NCBI-ProteinID: NP_001013878
RGD: 1310783
Ensembl: ENSRNOG00000054891
UniProt: Q6AXU9
Position
10q21
AA seq 557 aa AA seqDB search
MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSSSLWSLTHLTALHLSD
NSLSCIPSDIAKLHNLVYLDLSHNQIQSLPAELGNMVSLRELHLNYNQLRVLPFELGKLF
QLQTLSLKGNPLTQDILNLCLEPDGTRRLLNYLLDNLSGTAKRISTEQPPPRSWIMLQEP
DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIISLQE
VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANA
HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGTIPLVLCADLNSLPDSG
VVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGMTNGRITHGFKLKSAYENGLMPYT
NYTFDFKGIIDYIFYSKPQLNTLAILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL
LLPFLPQVNGIHLPGRR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagaaaagtacgagccccctgaccctcggaggatgtacacaattatgtcctct
gaggaagcagcaaatggaaagaaatcacattgggcagagcttgaaataagtggaaaagta
agaagcttaagctcatctttgtggtcactaactcacttgacagctttgcatctgagtgac
aattccctgtcctgtattccttcagacattgccaagcttcacaatctggtatatctggac
ctgtcccataatcaaatccagagtttaccggcagaactcggaaacatggtatcactcagg
gagctccatttaaattacaaccagttacgagttctaccttttgagctgggaaaactgttt
cagttgcagactttaagcctgaaaggaaatccacttacccaggatatattgaacctctgt
ctggagccagatggaacaagaaggctactgaactacttgctcgataatttgtcaggtact
gcaaaaagaatttcaacagaacaaccacctccaagatcttggatcatgttacaagaacca
gacagaacaaggccaacagccttgttttctgtcatgtgctataatgttctttgtgataaa
tatgcgacccggcagttatacggctactgtccatcatgggcactaaattgggactacagg
aaaaaggccattattcaagaaattttgagctgcaatgctgatattataagtcttcaggaa
gttgaaacagagcagtattacagtttttttctggtagaactgaaagaacgtggctataat
ggattctttagtcctaagtctcgagctaggactatgtctgaacaggaaagaaagcatgtt
gatggctgtgcaatattcttcaagactgaaaaatttactttggttcagaaacacacggtt
gaatttaatcagctagcaatggcgaattcagaagggtctgaagctatgttgaacagagtc
atgacaaaggataacattggagttgccgtactgctagaacttcgaaaggaattgattgaa
atgtcatctggaaaaccacatctgggaacagaaaaacaacttattcttgtggctaatgct
catatgcattgggaccctgaatactcagacgtgaagttggtgcaaactatgatgttcctt
tcagaagtgaagaatattattgataaagcctctcggagcctcaaatccagtgtattggga
gaatgtggaactattccacttgtgttatgtgcagatctgaattctttgccagactctggt
gttgtagagtatttgagcactggtggggtagaaacaaatcataaagactttaaggaactg
agatacaatgaaagtcttacaaacttcagctgcaatgggaagaatgggatgaccaatgga
agaatcacacatggtttcaagttaaagagtgcctatgagaatggcctgatgccttacacg
aattacacatttgatttcaagggtataattgactacatcttctattctaaacctcagctg
aatactttagccatcctgggacctctggaccaccattggctagttgagaataacatcagc
ggctgcccacatccacttattccctccgaccacttctcactttttgcacaattggagctc
ttactgcctttcctgccccaagttaatggcattcaccttcctggcaggaggtag

DBGET integrated database retrieval system