KEGG   Rattus norvegicus (rat): 287269
Entry
287269            CDS       T01003                                 

Gene name
Clk4
Definition
(RefSeq) dual specificity protein kinase CLK4
  KO
K23561  dual specificity protein kinase CLK1/4 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    287269 (Clk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    287269 (Clk4)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    287269 (Clk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     287269 (Clk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CLK family
   287269 (Clk4)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    287269 (Clk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Spo7_2_N
Other DBs
NCBI-GeneID: 287269
NCBI-ProteinID: NP_001013059
RGD: 1310274
Ensembl: ENSRNOG00000003714
UniProt: Q6AYK7
Position
10
AA seq 301 aa
MDGLHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPAHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTKRITLDEALQHPFFDLLKG
K
NT seq 906 nt   +upstreamnt  +downstreamnt
atggatggcttacatgtggcagtgaaaattgtaaaaaatgtaggccgttaccgggaggca
gctcgctctgaaatccaagtgctggagcacttgaacagcactgaccccaatagtgtcttc
cgatgtgtccagatgctagaatggtttgatcatcatggtcatgtttgtattgtgtttgag
ctgctgggccttagtacctatgattttattaaagaaaacagctttctgccatttcaaatt
gatcacatcaggcaaatggcttatcagatctgccaatctataaattttttacatcataat
aaattaacacacacggatctaaaacctgaaaatattttatttgtaaagtctgactatgtg
gtcaaatacaattctaaaatgaaacgagatgagcgcacgttgaaaaacacagatatcaaa
gttgttgactttggaagtgcgacatatgacgatgaacatcatagtactttggtgtccaca
agacactacagggctccagaggtcattttggctttaggttggtctcagccttgtgatgtt
tggagcataggctgcattcttattgagtattaccttggattcacagtctttcagactcat
gatagtaaagaacacctggcaatgatggagcggatactcgggcccatcccagcacacatg
atccaaaagacaaggaaacgcaagtatttccaccataaccagctagattgggatgagcat
agttcagctgggagatacgttaggagacgctgcaagccgttaaaggaatttatgctgtgt
cacgatgaagagcatgagaagctgtttgacctggttcgaagaatgttggagtatgaccca
acaaaaaggattaccttggatgaagctttgcagcaccctttctttgacttattaaaaggg
aaatga

DBGET integrated database retrieval system