KEGG   Rattus norvegicus (rat): 287275
Entry
287275            CDS       T01003                                 

Gene name
Sec24a
Definition
(RefSeq) SEC24 homolog A, COPII coat complex component
  KO
K14007  protein transport protein SEC24
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    287275 (Sec24a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287275 (Sec24a)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    287275 (Sec24a)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin Sen15
Other DBs
NCBI-GeneID: 287275
NCBI-ProteinID: NP_001099250
RGD: 1309451
Ensembl: ENSRNOG00000004563
UniProt: D3ZZA8
Position
10q22
AA seq 1089 aa
MAQPRIPAARGAAAGLQAQNGAASASGSPYTNGPVQHTLMSSQVSLSQGYDSQLPGSYPH
PMPAKTLNPFSAQSNYGGSQGSGQALNSPLVTSSPVPPSLHSGPVPRMALPTSQNPAATP
MPSGSFPPGTNPAPPLNWQYNHPSTGPQTNHFPHVAQPTIPGNTDFTADHPYVSSGDPAL
QTSFKKPGSALPLQNPPLPPTFQPGAPPGPPPAGGPPPSRGPVPQKTPPRAAFPPSLNSA
VNQEGITSNANTGSAAHSTYDEIEGGGFLATPQLVNQNPKTSRSVGYAYPSLPPGYQNTA
PPVAGMPPSSLNYPSGPQAFTQAPLGANHLTASMSGLSLHPEGLRVVNLLQERNMLPSTP
LQPPVPNLLEDVQKLNCNPELFRCTLTSVPQTQALLNKAKLPLGLLLHPFKDLVQLPVVT
SSTIVRCRSCRTYINPFVNFLDQRRWKCNLCYRVNDVPEEFMYNPLTRVYGEPHKRPEVQ
NATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAIETGYLNSVCQSLLDNLDLLPGNTRTKI
GFITFDSTIHFYSLQEGLSQPQMLIVSDIDDVFIPMPENLLVNLNESKELVQDLLKTLPQ
MFTKTLETQSALGPALQAAFKLISPTGGRMSVFQTQLPTLGVGALKPREEPNQRSSAKEI
HLTPSTDFYKKLALDCSGQQAAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYHHQHN
PVQVQKFQKELHRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAG
YAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEVFLGADVQAIS
GLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRSSVLSSQQPGLMVPFSLRLFPLFVL
ALLKQKSFQTGTNVRLDERIFAMCQVKNQPLVHLMLTTHPSLYRVDNLSDEGALNINDRT
IPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGRNCAQNFLSQVLGVQNYASIPQTMTDL
PELDTPESARMTAFISWLREQRPFFPILYVIREESLMKAAFLQNLVEDRTESALSYYEFL
LHIQQQVNK
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggcccagcccaggatcccggctgcccgcggcgccgcagccggcctccaggcccagaac
ggagccgcctcagcctcggggtctccctacaccaacggtcctgtccaacatacactgatg
tcttcacaagtatcactgagccaaggatatgattcccaacttccaggatcctaccctcat
ccaatgccagcaaagactttgaatccattctctgcacagtcgaactatggtggttctcag
ggatctggacaggctcttaatagtccacttgtgacttccagtccagtaccaccctcactt
catagtggtcctgttccccgaatggcactacctacttctcagaacccagctgctacacca
atgccttctggtagctttcctcctggaaccaaccccgccccgcctctgaattggcaatat
aaccatccatccacaggaccacagaccaatcattttcctcatgtagctcagccaactata
cctgggaatacagatttcacagcagatcatccgtatgtttcttctggagaccctgcactt
caaaccagcttcaaaaagccaggttctgcacttcccttacagaatccacctctgcctccc
acttttcagccaggagcccctcctgggcctcctccagctggaggcccgcctcccagccgg
ggccctgtgccccagaaaacacctcctagggctgcgttcccaccctcacttaactcagct
gtcaatcaagaaggtattacatcaaatgccaataccggatctgcggctcacagcacttac
gatgaaattgaaggaggtggcttcttggcaacaccacagcttgttaatcagaaccccaaa
acaagccgaagtgtgggatatgcatacccctccctaccaccaggctaccagaacaccgca
ccaccagtggctggaatgccaccctcctccctgaattacccaagtggtccccaggccttt
actcaggctcccttaggtgctaatcatttaactgcgagcatgagtggattaagtctacat
ccagagggtctaagagttgtcaatcttcttcaagaaaggaatatgcttccttcgacacca
ttgcagcctccagtcccaaacttgcttgaagacgtccagaaactcaactgtaacccagag
ttatttcgctgcacactgactagtgtccctcagactcaggccttactgaataaagccaag
cttcctttggggctgctgctccaccctttcaaggacctagtgcagttgcccgtagtcacc
tccagtacaattgtgagatgccggtcatgcaggacctacatcaacccctttgtcaacttt
ctggatcaaagaaggtggaaatgtaacttatgttatcgagtcaatgatgttcctgaagaa
ttcatgtacaatcctttaaccagagtttatggtgaacctcacaaaagacctgaagtccag
aatgctactattgagtttatggctccttcagagtacatgttacgaccaccacaacctcca
gtgtacctctttgtatttgacgtatctcacaacgcaatagaaactggatacttgaattca
gtttgccagagtttgttagacaatctggatctgcttcctggcaacactaggacgaagatc
ggtttcataacgtttgatagcactatccatttctacagccttcaggaaggtctctcccag
cctcagatgctaatagtttcagatattgacgatgtttttataccgatgccagagaactta
ctagtaaacttaaatgaaagtaaagagcttgtccaagatttactgaaaacgttaccgcaa
atgtttactaagacgctggagacccagagcgccttgggtcctgcacttcaggctgcattt
aagctgatatcaccaactggtggtcgaatgtctgtcttccaaacacaactcccaacgctt
ggtgtcggagccctgaaaccacgagaggaacccaaccaaaggtcatctgctaaggaaata
cacctgacaccatccactgacttctataagaagttagccttggactgctctgggcagcag
gcagccgtagacctattccttctcagtggacagtattccgatttggcttctctaggctgt
atctctcggtactcagcaggcagtgtgtattactatccctcgtaccaccatcagcacaat
ccagtgcaagttcagaaattccagaaggaactccacaggtaccttactcgcaagattgga
tttgaggcagtcatgaggatccggtgcaccaaaggtctttccatccatactttccatgga
aacttcttcgtccgttctacagacttactgtctcttcccaacgtaaacccggatgctggg
tacgcagtacagatgtccgtagaagagagcctcaccgacacgcagctggtttcctttcag
tcagcactcttatatacatcgagtaaaggtgaaagaagaatccgagtccatactttgtgt
ttgcctgtagtctctaccctgaatgaagtctttcttggagctgatgtgcaagcaatttca
gggttattggccaatatggctgttgataggtcagtgactgccagcctaagtgatgcccgg
gatgctctggtgaacgctgtcatagactctctctcagcttaccgctcttcagtcctgagt
agccagcagccaggcctcatggttcctttctccttgaggcttttcccactttttgtgttg
gctctccttaaacagaaatctttccagactgggacaaatgtacgtctagatgaacgaatt
tttgccatgtgtcaagtgaaaaaccagccgttggttcacctcatgctcacaacgcacccc
agtttgtacagagttgacaacctctcagatgagggagctctcaacatcaatgacagaacc
atacctcagccccccattcttcagctgtcggtggagaagttgagcagagatggagcgttc
ctcatggatgcaggctcagtactgatgctttgggttggaagaaattgtgcacagaatttt
ctcagccaagttctgggagttcaaaactatgcatcaattccacagacaatgacagacctt
ccagaacttgatacaccagaatctgccagaatgacagcttttatctcctggcttagagaa
cagaggccatttttcccaatactctatgtaatcagagaggagagtctgatgaaggcagcc
ttccttcagaacctggtagaagacagaacggagtcagcgctgtcatattatgaattcctc
ctgcacatacagcagcaagtgaacaagtga

DBGET integrated database retrieval system