KEGG   Rattus norvegicus (rat): 287280Help
Entry
287280            CDS       T01003                                 

Gene name
Skp1, Skp1a
Definition
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04710  Circadian rhythm
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Module
rno_M00380  SCF-BTRC complex
rno_M00381  SCF-SKP2 complex
rno_M00382  SCF-FBS complex
rno_M00387  SCF-FBW7 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    287280 (Skp1)
   04120 Ubiquitin mediated proteolysis
    287280 (Skp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    287280 (Skp1)
   04350 TGF-beta signaling pathway
    287280 (Skp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    287280 (Skp1)
   04114 Oocyte meiosis
    287280 (Skp1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    287280 (Skp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    287280 (Skp1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    287280 (Skp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    287280 (Skp1)
   03036 Chromosome and associated proteins [BR:rno03036]
    287280 (Skp1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     287280 (Skp1)
   Cul7 complex
     287280 (Skp1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     287280 (Skp1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     287280 (Skp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1 Skp1_POZ
Motif
Other DBs
NCBI-GeneID: 287280
NCBI-ProteinID: NP_001007609
RGD: 1359648
Ensembl: ENSRNOG00000005828
UniProt: Q6PEC4
Position
10q22
AA seq 163 aa AA seqDB search
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgataaagttgcagagttctgatggagagatatttgaagttgatgtagaaatt
gccaaacaatctgtgaccattaagaccatgctggaagatttgggaatggatgatgaggga
gatgatgatcctgttcctttaccaaatgttaatgcagcaattctaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctcctcctgaggatgatgagaacaaagagaag
cggacagatgatattcctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaacttattctggctgcaaactacttagacatcaaaggtttgcttgatgtcacctgc
aagactgtggctaatatgattaaggggaaaacgcctgaggagattcgtaaaaccttcaat
atcaaaaatgactttactgaagaggaggaggcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system