KEGG   Rattus norvegicus (rat): 287280
Entry
287280            CDS       T01003                                 

Gene name
Skp1
Definition
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04710  Circadian rhythm
rno05132  Salmonella infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    287280 (Skp1)
   04120 Ubiquitin mediated proteolysis
    287280 (Skp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    287280 (Skp1)
   04350 TGF-beta signaling pathway
    287280 (Skp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    287280 (Skp1)
   04114 Oocyte meiosis
    287280 (Skp1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    287280 (Skp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    287280 (Skp1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    287280 (Skp1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    287280 (Skp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    287280 (Skp1)
   03036 Chromosome and associated proteins [BR:rno03036]
    287280 (Skp1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     287280 (Skp1)
   Cul7 complex
     287280 (Skp1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     287280 (Skp1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     287280 (Skp1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 287280
NCBI-ProteinID: NP_001007609
RGD: 1359648
Ensembl: ENSRNOG00000005828
UniProt: Q6PEC4
Position
10
AA seq 163 aa
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcctacgataaagttgcagagttctgatggagagatatttgaagttgatgtagaaatt
gccaaacaatctgtgaccattaagaccatgctggaagatttgggaatggatgatgaggga
gatgatgatcctgttcctttaccaaatgttaatgcagcaattctaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctcctcctgaggatgatgagaacaaagagaag
cggacagatgatattcctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaacttattctggctgcaaactacttagacatcaaaggtttgcttgatgtcacctgc
aagactgtggctaatatgattaaggggaaaacgcctgaggagattcgtaaaaccttcaat
atcaaaaatgactttactgaagaggaggaggcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

KEGG   Rattus norvegicus (rat): 300084
Entry
300084            CDS       T01003                                 

Gene name
Rbx1
Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03420  Nucleotide excision repair
rno04066  HIF-1 signaling pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04710  Circadian rhythm
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    300084 (Rbx1)
   04120 Ubiquitin mediated proteolysis
    300084 (Rbx1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    300084 (Rbx1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    300084 (Rbx1)
   04350 TGF-beta signaling pathway
    300084 (Rbx1)
   04066 HIF-1 signaling pathway
    300084 (Rbx1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    300084 (Rbx1)
   04114 Oocyte meiosis
    300084 (Rbx1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    300084 (Rbx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    300084 (Rbx1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    300084 (Rbx1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    300084 (Rbx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    300084 (Rbx1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    300084 (Rbx1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     300084 (Rbx1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   300084 (Rbx1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     300084 (Rbx1)
   ECV complex
     300084 (Rbx1)
   Cul3 complex
     300084 (Rbx1)
   Cul4 complex
     300084 (Rbx1)
   Cul7 complex
     300084 (Rbx1)
   Cul9 complex
     300084 (Rbx1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      300084 (Rbx1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      300084 (Rbx1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Other DBs
NCBI-GeneID: 300084
NCBI-ProteinID: NP_001029307
RGD: 1308453
Ensembl: ENSRNOG00000058914
UniProt: Q498D8
Position
7
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcggcgatggatgtggatacccccagcggcaccaacagcggcgcgggcaagaag
cgctttgaagttaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgtatcgagtgtcaggccaaccag
gcctcagctacttcggaagagtgcacggttgcttggggagtctgtaaccacgcttttcat
ttccactgcatctctcggtggctcaaaaccaggcaggtgtgccccttggacaacagagag
tgggagttccaaaagtatgggcattag

KEGG   Rattus norvegicus (rat): 362356
Entry
362356            CDS       T01003                                 

Gene name
Cul1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04350  TGF-beta signaling pathway
rno04710  Circadian rhythm
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    362356 (Cul1)
   04120 Ubiquitin mediated proteolysis
    362356 (Cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    362356 (Cul1)
   04340 Hedgehog signaling pathway
    362356 (Cul1)
   04350 TGF-beta signaling pathway
    362356 (Cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    362356 (Cul1)
   04114 Oocyte meiosis
    362356 (Cul1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    362356 (Cul1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362356 (Cul1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    362356 (Cul1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    362356 (Cul1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     362356 (Cul1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 DUF4980
Other DBs
NCBI-GeneID: 362356
NCBI-ProteinID: NP_001102097
RGD: 1308157
Ensembl: ENSRNOG00000005310
Vega: OTTRNOG00000001405
UniProt: B1WBY1
Position
4
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcaaacaggagtcagaatcctcatggactgaagcagatcggtcttgaccagatc
tgggatgacctcagagctggaattcagcaagtgtacaccagacaaagcatggcaaagtcc
agatacatggagctctacactcatgtttataactactgtactagtgtgcatcagtccaac
caagcccggggtgctggagtccctccttccaagtcaaaaaaggggcagactcctggggga
gctcagtttgtcggcttggagttatacaagcgattgaaggagtttttgaagaattacttg
acaaatcttcttaaggatggagaagatttaatggatgagagtgtgctgaagttctacact
cagcagtgggaagattaccgattctccagcaaagtgctgaatggaatctgtgcctacctc
aatagacattgggttcgtcgcgaatgtgatgaaggacgaaaaggaatatatgaaatctat
tcgcttgcgttggtgacatggagagattgtttgttcaggccattgaataaacaggtaaca
aatgctgttttaaaactgattgagaaggaaagaaatggcgaaaccatcaatacaagactg
attagtggagttgtacaatcttatgtggaattgggactgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagaaagtactgaattcttacagcagaacccagttactgaatat
atgaaaaaggctgaagctcgtctgcttgaggaacagcggagagttcaggtttatctccat
gagagcacacaagatgagctagcacggaaatgtgagcaggtcctcattgaaaaacacttg
gaaatttttcacacagagtttcagaatttgttggatgctgacaagaatgaagatttgggc
cgcatgtataatcttgtatctagaattcaggatggcctaggagaattgaaaaaactacta
gagacacatattcataatcagggtcttgcggcaattgagaagtgtggagaagctgctctg
aatgaccccaagatgtatgtgcagacagtgctggatgttcataaaaaatacaatgccctg
gtgatgtcagcattcaacaacgatgctggcttcgtggctgcacttgataaggcttgtggt
cgcttcataaacaacaatgcagttaccaaaatggcccagtcatccagtaaatcccctgag
cttcttgctcggtactgtgactccttgttgaagaaaagttctaagaacccagaagaggca
gaactagaagataccctcaatcaagtgatggtggtcttcaagtacatcgaggacaaagat
gtatttcagaagttctatgcaaagatgcttgccaagagactggtacatcagaacagtgcg
agtgacgatgctgaagcaagcatgatctctaaattaaagcaagcttgtggttttgagtac
acttccaaactccagcgaatgtttcaagacattggtgtaagcaaagatctaaatgaacag
ttcaaaaagcacctgacgaattcagaaccactggacttggacttcagtattcaggtcctg
agttccggatcatggccctttcagcagtcttgcacgtttgccttgccgtcagagttggag
cgcagttaccaacggtttacagctttctacgccagccgtcacagtggcagaaaattgaca
tggttgtatcaactgtccaaaggggaactagtcactaactgcttcaaaaacagatacact
ttgcaggcgtccacattccagatggccatcctgcttcagtacaacacagaagacgcctat
actgtgcagcagctgaccgacagcactcagattaaaatggacattttggcacaagtccta
cagattttactgaagtcaaaattgctggtcttagaagatgaaaatgccaatgttgatgag
gtggaattgaagccagacaccttaataaagttatatcttggttataaaaataagaaattg
agggttaatatcaatgtaccaatgaaaactgaacagaagcaggaacaagaaaccacacac
aaaaatatagaggaagaccgcaaactactgattcaggcggccatcgtaagaatcatgaaa
atgaggaaggttctgaaacaccagcagttacttggtgaagtcctcactcagctgtcctcc
aggttcaaacctcgggtcccagtgatcaagaaatgcattgatattctcatcgaaaaagaa
tatttggagcgagtcgatggtgagaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system