KEGG   Rattus norvegicus (rat): 287302Help
Entry
287302            CDS       T01003                                 

Gene name
Mrpl22
Definition
(RefSeq) mitochondrial ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    287302 (Mrpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    287302 (Mrpl22)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    287302 (Mrpl22)
  Bacteria
    287302 (Mrpl22)
  Archaea
    287302 (Mrpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 287302
NCBI-ProteinID: NP_001099251
RGD: 1309277
Ensembl: ENSRNOG00000027039
UniProt: P0C2C0
Position
10q22
AA seq 206 aa AA seqDB search
MAAALLRELGALWVPNLRIWTTQMLRVLPQSCIHTSTSLDISRRWEKKNKIVYPPQLPGE
PRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAQIIKEVLLEAQD
MAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPRP
EAPRTAVDHAKEYIQQLRSRTIIHTL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcactgctgcgagagttgggtgcactgtgggtacctaacctgaggatctgg
acaactcagatgctgcgagttttaccgcagtcgtgtatccacacaagcacttctcttgac
atttctcgaagatgggagaagaagaataagattgtttacccgcctcagctgcctggcgag
cctcggagaccagcagaaatttaccattgtcggagacagataaaatacagcaaggacaag
atgtggtacctggcaaaattgatacgaggcatgtccattgatcaggctttggctcagctg
gagttcaatgataaaaagggggctcaaataattaaagaggttctcttagaagcacaagac
atggcagtgagagaccataatgtggaattcagatccaacttacacatagctgagtctacc
tcaggtcgaggccagtgcctgaagcgcatccgttaccatggccgaggtcgctttggcatc
atggagaaggtctactgccactactttgtgaagctggtggaaggaccgccaccccgaccc
gaagcaccgaggacagcagttgaccacgccaaggagtatattcagcagctgcgcagccgg
accatcatccacacgctatga

DBGET integrated database retrieval system