KEGG   Rattus norvegicus (rat): 287314
Entry
287314            CDS       T01003                                 

Gene name
Olr1416, ratchr10-44162573-44161644_ORF
Definition
(RefSeq) olfactory receptor 1416
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    287314 (Olr1416)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    287314 (Olr1416)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    287314 (Olr1416)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 287314
NCBI-ProteinID: NP_001000009
RGD: 1332603
Ensembl: ENSRNOG00000046967
UniProt: D4AAZ7
Position
10q22
AA seq 309 aa
MNNYTEQSGFTLVGFLSQSKDPALLSVVIFVVFLMALSGNILLILLILSDTHLHTPMYFF
ISQLSLMDMMYISVTVPKMLMDQVLGNHRISAAACGMQMFLYLTLAGSEFLLLAAMSYDR
YVAICHPLRYHVLMNHRVCLLLISSCWLLGSLDGFMFTPVTMTFPFCGSRKIYHFYCEVL
TVTKLSCSDTWLYETFMYVCCVVMLLIPVTVISGSYSSILLTVLRMNSTEGRKKALATCS
SHMTVVILFYGTAIYNYMLPASLHTPEKDMVVSVFYTILTPLLNPLIYSFRNKNVTEAMR
KWLGLSPLF
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaacaactacactgaacagtcaggtttcaccctggtgggattcttaagtcaatccaaa
gaccctgccctgctttctgtcgtcatatttgtggttttcctgatggccttgtctgggaac
atccttctgatcctgttgatactctctgacacacacctccacacacccatgtactttttt
atcagccagctgtctctcatggacatgatgtacatttctgtcactgtgcccaagatgctc
atggaccaggtcctggggaaccacaggatctcagctgctgcctgtgggatgcagatgttc
ctctacctgacactagcaggttcagaatttttgcttctagctgccatgtcctatgaccgc
tatgtggccatctgccatccactccggtatcatgtcctcatgaaccacagggtatgtctt
ctcctgatatcttcatgttggctcctgggatccttagatggcttcatgttcacccctgtc
accatgaccttcccattctgtggatctcggaagatctatcacttctactgtgaggttctt
actgtgacaaagctctcctgctcagacacctggctctatgagaccttcatgtatgtgtgc
tgtgtggtcatgcttctcattcctgtgacagtcatttcaggatcctactcatccatcctc
ctcactgttctcaggatgaattcaacagagggcaggaagaaggctcttgcaacctgctcc
tcccacatgactgtggtcatcctcttctatggcactgctatctataactacatgctccct
gcctccctccacacccctgagaaggacatggtagtgtctgtgttttacaccatactcaca
cctctgttgaacccactaatatatagttttaggaataagaatgtcactgaagctatgagg
aaatggttgggtttgagccccctcttctaa

DBGET integrated database retrieval system