KEGG   Rattus norvegicus (rat): 287316
Entry
287316            CDS       T01003                                 

Gene name
Olr1425
Definition
(RefSeq) olfactory receptor 1425
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    287316 (Olr1425)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    287316 (Olr1425)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    287316 (Olr1425)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 287316
NCBI-ProteinID: NP_001000010
RGD: 1332670
Ensembl: ENSRNOG00000052623
UniProt: M0R499
Position
10q22
AA seq 315 aa
MNNYTGQFSDFTLLGFFSQYKYPTLLAGVIFVVFLMALSGNAFLILLILFDTQLHTPMYF
FISQLSLMDMMYISVTVPKMLMDQVLGNHRISAAACGMQMFLYLSLGGSEFLLLAAMSYD
RYVAICHPLRYPVLMNHRVCLLLLSVCWFLGSLDGFMLTPVTMTFPFCGSREIHHFFCEV
PAVTKLSCSDTWLYETLMYVCCVLMILIPVTVISGSYSSILLTVLRMNSPEGRKKALATC
SSHMTVVILFYGAAVYTYMLPTSFHTPEKDMVVSVFYTILTPLLNPLIYSFRNKNVTEAM
KKLLGVSTLFQEIIK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaacaactacactggacaattttcagatttcaccctgcttggattcttcagtcaatac
aaataccctactctgcttgctggggtcatatttgtggttttcctgatggccttgtctggg
aacgccttcctgatcctgttgatcctctttgacacccaactccacacacccatgtacttt
tttatcagccagctgtccctcatggacatgatgtacatttctgtcactgtgcccaagatg
ctcatggaccaggtgctggggaaccacaggatctcagctgctgcctgtgggatgcagatg
ttcttgtatctgtcactgggagggtcagaatttttgcttctagctgccatgtcctatgac
cgttatgtggccatctgccatccactccggtatcctgtccttatgaaccacagggtgtgt
ctcctcctgttgtctgtctgttggttcctgggatccttagatggcttcatgctcacccct
gtcaccatgaccttcccattttgtggatcgcgggagatccatcacttcttctgtgaggtt
cctgctgtgacaaagctctcctgttcagacacctggctctatgagaccctcatgtatgtg
tgctgtgtgctcatgattctcattcctgtgacagtcatttcaggctcctactcatccatc
ctcctcactgttctcaggatgaactcaccagagggcaggaagaaggctcttgccacctgc
tcctcccacatgacggtggtcattctcttctatggtgctgctgtctatacctacatgctc
cctacctcattccacacccctgaaaaggacatggtggtgtctgtgttttacaccatactc
acacctctgttgaacccactaatatatagttttaggaataagaatgtcactgaggctatg
aagaaactgctgggtgtcagcactctcttccaggaaatcataaagtaa

DBGET integrated database retrieval system