KEGG   Rattus norvegicus (rat): 287324
Entry
287324            CDS       T01003                                 

Gene name
Olr1436
Definition
(RefSeq) olfactory receptor 1436
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    287324 (Olr1436)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    287324 (Olr1436)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    287324 (Olr1436)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 287324
NCBI-ProteinID: NP_001000014
RGD: 1332835
Ensembl: ENSRNOG00000046642
UniProt: M0R8H1
Position
10q22
AA seq 306 aa
MEKGNHSCGTDFTLVGLFQYGHTDTFLFTVIILLFAVALIGNITLVHLIRLDRTLHTPMY
FLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCVIQAFVFLTLGASEALLLGFMSY
DRYIAICQPLHYPVLMSRKICCSMVAGAWSSSSINALVHTVYVFQLPFCGSRIVNHFFCE
VPSLLPLVCEDTSQYEHTILLSGLVILLLPFLAILASYARVLVVVFRMGSGKGQSRAVST
CSSHLTVASLFYVTTLSTYTQPHSLHSPGRDKVVAVLYSIITPVLNPFIYSLRNKEVMGA
LRRHMG
NT seq 921 nt   +upstreamnt  +downstreamnt
atggagaaaggaaaccacagctgtggaacagacttcaccttggttggccttttccagtat
ggacacacggacacctttctcttcacagttatcatcctgctttttgcagtggctctcata
ggcaacatcacactggtccacctcatcaggctggaccgaaccctccacacccccatgtac
ttcctcctcagtcagctctccatcattgacatgatgtacatctccaccactgtgcccaag
atggcagctaacttcctgtcagacactaagaccatttcctttctgggatgtgtgatccaa
gcatttgtgtttctgactctgggtgcatctgaagccctcttgctgggtttcatgtcctat
gacaggtacatagccatctgccagcccttgcactaccctgtgctcatgagcaggaagatc
tgctgctccatggtcgctggtgcctggagtagcagctccatcaatgctttagtgcacaca
gtgtatgtatttcaacttccattctgtggatctaggattgttaaccactttttctgtgag
gttccatctctcctgccactggtgtgtgaagacacgtcccaatatgagcatacaatcctc
ctgagtggccttgtcattctgttgttacccttcctggccatcctagcttcctatgctcga
gtgttggttgttgtattccggatgggttcagggaagggacagagtagagctgtgtccacc
tgctcctcccacctgaccgtggccagcctgttctatgtcactactctctccacctacacc
cagccacactccttgcattctcctgggagggacaaagtggtggctgtgctctactctatc
atcacccctgttctgaaccctttcatctacagcctgaggaacaaggaggtcatgggggcc
ctgaggagacatatgggatga

DBGET integrated database retrieval system