KEGG   Rattus norvegicus (rat): 287362
Entry
287362            CDS       T01003                                 

Gene name
Nlrp3
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05164  Influenza A
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    287362 (Nlrp3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    287362 (Nlrp3)
   04625 C-type lectin receptor signaling pathway
    287362 (Nlrp3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    287362 (Nlrp3)
   05164 Influenza A
    287362 (Nlrp3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    287362 (Nlrp3)
   05135 Yersinia infection
    287362 (Nlrp3)
   05133 Pertussis
    287362 (Nlrp3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    287362 (Nlrp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287362 (Nlrp3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    287362 (Nlrp3)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    287362 (Nlrp3)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   287362 (Nlrp3)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 PYRIN LRR_6 NOD2_WH FISNA LRR_4 DUF3747
Other DBs
NCBI-GeneID: 287362
NCBI-ProteinID: NP_001178571
RGD: 1308314
Ensembl: ENSRNOG00000003170
UniProt: D4A523
Position
10
AA seq 1035 aa
MKMMSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCVPIPRGQMEKADHLDLATLMID
FNGEEKAWGMAVWIFAAINRRDLWEKAKKDQPEWNDACTSNLSMVCQEDSLEEEWIGLLG
YLSRISICKKKKDYCKIYRRHVRSRFYSIKDRNARLGESVDLNRRYTQLQLVKEHPSKQE
REHELLTIGRTKMWDRPMSSLKLELLFEPEDEHLEPVHTVVFQGAAGIGKTILARKIMLD
WALGKLFKDKFDYLFFIHCREVSLRAPKSLADLIISCWPDPNPPVCKILCKPSRILFLMD
GFDELQGAFDEHIEEVCTDWQKAVRGDILLSSLIRKKLLPKASLLITTRPVALEKLQHLL
DHPRHVEILGFSEAKRKEYFFKYFSNELQAREAFRLIQENEILFTMCFIPLVCWIVCTGL
KQQMETGKSLAQTSKTTTAVYVFFLSSLLQSRGGIEEHLFSAYLPGLCSLAADGIWNQKI
LFEECDLRKHGLQKTDVSAFLRMNVFQKEVDCERFYSFSHMTFQEFFAAMYYLLEEEEEG
VTVRKGPEGCSDLLNRDVKVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKI
SQQVRLELLKWIEVKAKAKKLQRQPSQLELFYCLYEMQEEDFVQSAMGHFPKIEINLSTR
MDHVVSSFCIKNCHRVKTLSLGFLHNSPKEEEEEKRGSQPLDQVQCVFPDPHVACSSRLV
NCCLTSSFCRGLFSSLSTNQSLTELDLSDNTLGDPGMRVLCEALQHPGCNIQRLWLGRCG
LTHQCCFNISSVLSSSQKLVELDLSDNALGDFGVRLLCVGLKHLLCNLQKLWLVSCCLTS
ACCQDLALVLSSNHSLTRLYIGENALGDSGVQVLCEKMKDPQCNLQKLGLVNSGLTSLCC
SALTSVLKTNQNLTHLYLRSNALGDMGLKLLCEGLLHPDCKLQMLELDNCSLTSHSCWDL
STILTHNQSLRKLNLSNNDLGDLCVVTLCEVLKQQGCLLQSLQLGEMYLNCETKRTLEAL
QEEKPELTVVFEISW
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgaagatgatgagtgttcgctgcaagctggcccagtatctagaggacctggaagatgtg
gacctcaagaaatttaaaatgcatttggaagattacccacccgagaaaggctgtgttccg
atccccaggggccagatggagaaggcagatcacttggatctagccacactcatgattgac
ttcaatggggaggagaaggcgtggggcatggctgtgtggatctttgcagcgatcaacagg
cgagacctctgggaaaaagctaagaaggaccagccagagtggaatgatgcatgcacgtct
aatctctccatggtgtgccaggaagacagccttgaagaggagtggataggtttgctggga
tatctctcccgcatctcgatttgtaaaaaaaagaaagattactgtaagatatacagaagg
catgtgagaagcaggttctactccatcaaagacaggaatgcacgtctaggtgagagcgtg
gacctcaacagacgctacacccagctccaactggtcaaggagcatccaagcaagcaggaa
agggagcatgaactcttgaccattggcaggactaagatgtgggacaggcccatgagctcc
cttaagctggagctgctctttgagcctgaggatgaacacttggagcccgtgcacacagtg
gtgttccagggagcagcaggcatcggaaaaacaatcctagccaggaagattatgttggac
tgggccttggggaagctcttcaaagacaaatttgattatttgttctttatccactgtcga
gaggtgagcctcagggcaccaaagagcctagcagatctcattatcagctgctggcctgac
ccaaacccaccagtctgcaagatcctgtgcaagccttccaggatcctcttcctcatggac
ggctttgatgagctgcagggggcctttgatgagcacatcgaggaggtctgcacagactgg
cagaaggctgtgaggggagacattctgctaagcagcctcatccgaaagaagttgctgcct
aaggcctctctgcttattacgacgaggccagtagccttggagaagctgcagcatctcctg
gaccacccccgccacgtggagatcctaggtttctctgaggccaaacggaaggagtatttc
tttaagtatttctcaaacgagctgcaggccagggaggccttcaggctgatccaagagaat
gagatcctgtttactatgtgcttcatccccctggtctgctggattgtgtgcacagggcta
aagcagcagatggagactggaaagagcttggcccagacctccaagaccacgactgccgtc
tatgtctttttcctttccagcctgctgcagtcccgggggggcattgaggagcacctcttc
tctgcctacctgccagggctctgttcattggctgcggatggaatttggaaccagaagatc
ctatttgaagagtgtgatctgcggaaacacggcctgcagaagaccgacgtctctgctttc
ctgagaatgaacgtgttccagaaggaggtggactgcgagagattttacagcttcagccac
atgactttccaggagttctttgcggctatgtactatctgctagaagaggaggaagagggg
gtgaccgtgaggaagggaccagaaggctgttcagaccttctgaaccgagacgtgaaggtc
ctattagaaaattacggcaagttcgaaaaaggctatctgatttttgttgtacgcttcctc
tttggccttgtaaaccaggagagaacttcttatttggagaagaagctaagttgcaagatc
tctcagcaagtcagactggagctgctgaagtggatcgaagtgaaagccaaggccaagaag
ctgcagaggcagcccagccagctggaactgttctactgcttgtacgagatgcaggaggaa
gactttgtgcagagcgccatgggccacttccccaaaattgagatcaacctctctaccaga
atggaccacgtggtttcttccttttgcattaagaattgccatagggtaaaaacactttcc
ctgggatttctccacaactcacccaaggaggaagaagaagagaaaagaggaagtcaaccc
ttggaccaggtccagtgtgttttcccagaccctcatgttgcctgttcttccagactggtg
aactgctgcctcacctctagcttctgccgaggtctcttctcaagtctcagcaccaaccag
agcctcactgaactggacctcagtgacaatactctaggggatccaggcatgagggtgctg
tgtgaggcactccagcacccaggctgtaacattcagagactgtggttggggcgctgcgga
ctgacccatcaatgctgtttcaacatctcctctgtcctgagcagcagccagaagctggtg
gagctggacctcagtgacaatgccctgggggactttggagtcagactgctgtgcgtggga
ctgaagcatctgctctgcaacctgcagaaactctggttggtcagctgctgtctcacatct
gcgtgttgtcaggatctcgcattggttctgagctccaaccattctctgaccagactgtac
attggagaaaatgccttgggagactcaggagttcaagttttgtgtgaaaaaatgaaggac
ccacagtgtaacttgcagaagctggggttggtgaattccggccttacttcactgtgctgc
tcagctctgacctctgtgctcaaaaccaaccagaacctcacacacctgtacctacgaagc
aatgcccttggagacatgggactcaagctcctctgtgagggacttctgcaccccgactgt
aagctacagatgctggagttagacaactgcagcctcacctcacactcctgctgggatctc
tccacaattctgacccataaccagagcctccggaagctgaacttgagcaacaacgacctg
ggcgatctgtgtgtggtgacgctctgtgaggttctgaaacagcagggctgcctcctgcag
agcctacagttgggtgaaatgtatttaaattgtgaaacaaaacgtaccttagaagctctc
caggaggaaaagcctgagctgactgttgtttttgagatttcttggtag

DBGET integrated database retrieval system