KEGG   Rattus norvegicus (rat): 287379Help
Entry
287379            CDS       T01003                                 

Gene name
Shmt1, LRRGT00032, Shmt, mShmt
Definition
(RefSeq) serine hydroxymethyltransferase 1
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno00670  One carbon pool by folate
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno01523  Antifolate resistance
Module
rno_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    287379 (Shmt1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    287379 (Shmt1)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    287379 (Shmt1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    287379 (Shmt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     287379 (Shmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SHMT Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 287379
NCBI-ProteinID: NP_001041307
RGD: 1312011
Ensembl: ENSRNOG00000005275
UniProt: Q6TXG7
Position
10q22
AA seq 681 aa AA seqDB search
MELTVEAWVQIFLLPVEKSDPVSRLDPDRMGHVKGPVQMIQNCRISTTQGNNRITQRSPG
YTPDSPTKSFSLWNSQNLLVQSMKLAASAVSIWFWGSWRIPRELLVFSLHWNLKEVGLST
SPSNSTNLPARVKGKQAEKQSFLLLSSFIWVAIRSYSSFCQVLPKFLLRARANGAWAAEG
GLYLDPPTDWAALGVGRGQPRCAMAERDATVWASHEKMLTQPLKESDAEVYSIIKKESNR
QRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQA
YHLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISAT
SIFFESMPYKVYPDTGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGA
YLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVRSVDPKTGEE
TYYELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALT
ELGYKIVTGGSDNHLILMDLRPKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLRL
GTPALTSRGLLEEDFQKIAHFIHRGIELTLQIQSHMTMRATLKEFKEKLTGDEKFQSAVA
ALREEVENFASNFSLPGLPDF
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggagctgactgtggaggcatgggtgcagatattcctgcttccagttgagaagtccgat
cctgtgtcgaggctggaccctgacaggatgggacatgtgaaagggccagttcagatgatc
cagaactgcagaatctccacgacacagggcaacaacaggataacccagaggagtcctgga
tacactccagatagtcctacaaagtccttctcactgtggaacagccaaaatctgctagtt
cagtccatgaaactggctgcctcagcagtctcaatctggttctggggttcttggaggatt
cctagagagctgctggttttcagtttacattggaatcttaaggaagttggacttagcacc
agccccagcaacagcacaaacttgccagcaagagtaaaaggcaagcaggcagaaaagcaa
agcttccttcttctaagttcttttatctgggttgccatcagaagctacagctccttttgt
caggttttgcccaagtttctgctccgagctcgggcgaatggcgcctgggcggctgagggc
gggctctacctggacccgcccactgattgggccgctctaggggtggggcggggccagccg
cgctgtgcaatggcagagagggatgccaccgtgtgggcctctcatgagaagatgttgaca
cagcccctgaaggagagcgatgctgaggtttacagcatcattaaaaaggagagcaaccgg
cagagggtcggattggagctgattgcctcggagaactttgccagcagagctgtgttggag
gccctaggatcttgcttaaataacaaatactctgaggggtacccaggccaaaggtattat
ggtgggactgagttcatcgatgagctggagacgctgtgtcagaagcgtgcattacaggcc
taccatctggatcctcagtgctggggcgtcaatgtccagccttattcaggctcccctgca
aactttgctgtgtatactgccctagtagagccccatgggcgaatcatgggtttggacctg
ccagatggtggccatctgactcatggcttcatgacagacaagaagaaaatctctgccacc
tctatcttctttgaatccatgccttataaggtatacccagacactgggtacatcaactat
gaccagctagaggagaatgccagcctcttccacccgaagctgatcattgcagggaccagc
tgctactcccggaacctggactatgcgcggctgcgaaagattgcggatgataatggggca
tatctcatggcagacatggcacacatcagtgggctcgtggcagctggtgtggtgccctca
ccctttgaacactgtcatgtagtaaccactacaacccacaagaccctgagaggctgccgt
gctggtatgatattctacagaaagggtgtgcgcagtgttgatcccaagactggcgaagag
acttactatgaactggagtccctcatcaactcggccgtgttcccaggcctgcagggcggc
cctcacaaccatgccattgctggtgttgctgtggccctgaagcaagccatgactacagaa
ttcaaaatctaccagctccaggtgttggccaactgcagggctctgtctgatgcactcaca
gagctaggctacaaaatagtcacaggtggctctgataatcacttgatcctaatggatctg
cgtcctaagggtactgatggcggaagggctgagaaggtactggaagcctgttctatcgcc
tgcaacaagaatacctgcccaggtgacaagagtgcgttacggcccagtggcctgcgactg
ggaactccagcattgacatcccgaggacttttggaagaagacttccaaaaaatagcacac
tttatccacagagggatagagttgactctgcagattcagagccacatgaccatgagggcc
acactgaaagagttcaaggagaagctgacaggggatgagaagttccagagtgctgtggca
gctctccgggaagaagtggagaattttgcttccaacttctcactacctggacttcctgac
ttctga

DBGET integrated database retrieval system