KEGG   Rattus norvegicus (rat): 287380Help
Entry
287380            CDS       T01003                                 

Gene name
Dhrs7b, RGD1311243
Definition
(RefSeq) dehydrogenase/reductase 7B
  KO
K11166  dehydrogenase/reductase SDR family member 7B [EC:1.1.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    287380 (Dhrs7b)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     287380 (Dhrs7b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 THF_DHG_CYH_C
Motif
Other DBs
NCBI-GeneID: 287380
NCBI-ProteinID: NP_001008507
RGD: 1311243
Ensembl: ENSRNOG00000005360
UniProt: Q5RJY4
Position
10q22
AA seq 325 aa AA seqDB search
MISPSSRKGMLKERAMDLVTQTTILPLLFGCLGIFSLFRLLQRTRSKAYLRNAVVVVTGA
TSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTHQPCVVTFDLADPG
AIAPAAAEILQCFGYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPS
MVERKRGHIVAISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVISPGYI
HTNLSVNAVTADGSRYGALDKNTAQGRSAVEVAQDIFDAVGKKKKDVLLTDFLPTMAVYI
RTLAPRLFFRIMASRARKERKSKNS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatttctccgtcctctaggaagggtatgctcaaggagagggccatggacttggtcacc
cagacgaccatcctacccctgctgtttggctgcctggggattttcagcctgttccggctg
ctccagcggacccgttcaaaagcttacctgaggaatgctgtggtggtagttacaggtgcc
acctcaggtctcggcaaagaatgtgcccgagtcttccatgctgcgggggctaaagtggtc
ctctgtggacgaaatgtgaaggctcttgaggagttcacccgtgaacttgctgattcttct
tcttctcagggacagacacaccagccctgcgtggtgacctttgacctcgcagatcctggt
gctattgctccagcagcagctgagatcctacagtgctttggctatgtggacatcctcatc
aataatgctggcatcagctaccgtggtgccattagtgataccatagtggatgtggaccgg
aaggtgatggaaataaactattttggccctgttgctctaacaaaagcgctcctaccctcc
atggtagaaaggaagagaggccacatcgtcgccatcagcagcatccagggcaagatcagc
attccttttcggtcagcatacgcagcgtccaagcatgcgacccaggcattctttgactgt
ctgcgtgcagagatgaaagacagtgacatcgaggtgactgtgataagccctggctacatc
cataccaacctctctgtaaacgctgtcactgctgatggctccagatatggagctctagac
aagaacacagcccagggccgaagcgctgtggaggtggcccaggatatctttgatgctgtg
gggaagaagaaaaaagatgttctcttgactgactttctgccaaccatggctgtctacatc
agaactctggctcctagacttttcttcagaatcatggcctctagggccaggaaagagcga
aaatccaagaactcctga

DBGET integrated database retrieval system