KEGG   Rattus norvegicus (rat): 287392
Entry
287392            CDS       T01003                                 

Gene name
Tekt3
Definition
(RefSeq) tektin 3
  KO
K18630  tektin-3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    287392 (Tekt3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     287392 (Tekt3)
SSDB
Motif
Pfam: Tektin PKHD_C Baculo_PEP_C
Other DBs
NCBI-GeneID: 287392
NCBI-ProteinID: NP_001019910
RGD: 1310582
Ensembl: ENSRNOG00000027212
UniProt: Q4V8G8
Position
10q23
AA seq 490 aa
MEPLGSTLTATYAHPQPAATNFLPAIGTLTSSYRNRFPHRNLTHSLSLPWRPSTYYKTAY
NYPTLAPLSSTSQSVCESTMLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERL
RVDTSRLIQDKYQQIRKTQADSTQNLGERVNDIAFWKSEIIHELDEMIGETNALTDIKRR
LERGLIETDAPLQVARECLFHREKRMGIDLVHDEAEKELLTEVETVLCCQERMRRHLDKA
IAQLASDRSAQHELEKDLSDKQAALRIDDKCKHLRNTSQGVSYFRGVENVDATVSVPESW
AKFTDDNVLRSQSERAASAKLREDTENLLIVIANEMWNQFNKVNVAFTNRIAETVDAKNK
IHIHLSKTLQEIFQTEMAIESIRKAIKEKSAFLKVAQTRLDERTRRPNIELCRDIAQLRL
VNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSY
PSTLRLVGFC
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaacctctaggttctactttaacagctacttatgcccaccctcaacctgcagcaacc
aactttctaccagccattggtaccttaacatcgagctatcggaaccgttttccccatcgt
aatctaacacacagcttgagccttccatggagaccaagcacatactacaaaacggcctac
aactacccaaccttggccccattgtcctcgacatctcagagtgtgtgtgagagcactatg
ctccccttcgtgtccaacagaaccacgctcttcacaaggtacacccctgatgactggtac
cgttccactctagtcggcttccaggagtccaattgctcacgccataattcagagagactc
agagtggatacatctcggctcattcaagacaaataccagcagatccggaagacccaggct
gactctacccaaaacctgggagaacgagtcaatgacatagcattttggaaatcggaaatc
atacatgagttggatgaaatgattggggagacaaatgcactgaccgatattaagagaagg
ctggagaggggtttgatagagactgatgcccctctgcaggttgcccgagagtgtctcttt
caccgagagaagagaatggggatcgatctcgtgcatgacgaagccgagaaagaactactg
acggaagttgaaaccgttctgtgttgccaagaaagaatgaggcgacatctggataaggcg
atagcccaactggcctcagacagatctgcgcagcacgagcttgagaaggatctgagtgac
aaacaggctgccctccggattgacgataaatgcaagcacctgcggaacacttctcagggc
gtcagctacttccgcggggtggagaatgtcgatgcaacggtatcggtgcccgagtcatgg
gccaagtttacggatgacaatgttctccgctcgcagagtgaaagggcagcttctgctaag
ctaagagaggacaccgagaaccttctgattgtgatagccaatgagatgtggaatcagttc
aacaaagtgaacgtggctttcaccaatcgcattgccgagactgttgatgccaagaacaag
atccacattcacttatcgaagaccctgcaggagatcttccagactgaaatggccatagaa
tccatcagaaaggccatcaaggagaagtctgccttcctgaaggtggcgcagacccggctg
gatgagagaacgaggaggccgaacatagagctgtgcagagatatagctcagctacgcctt
gttaacgaggtctacgaggtggacgaaaccatccagactctgcagcagcgcctgagggat
tcggaggacaccctgcagtccttggcccataccaaagccaccctggagcacgacttggct
gtgaaagccaacactctgtacatcgaccaggaaaaatgcatgagcatgcgcaatagctac
cccagtaccctccggctggtcggcttctgttag

DBGET integrated database retrieval system