KEGG   Rattus norvegicus (rat): 287398
Entry
287398            CDS       T01003                                 

Gene name
Map2k4, MKK4, Sek1
Definition
(RefSeq) mitogen activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04912  GnRH signaling pathway
rno04926  Relaxin signaling pathway
rno04935  Growth hormone synthesis, secretion and action
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05142  Chagas disease
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    287398 (Map2k4)
   04012 ErbB signaling pathway
    287398 (Map2k4)
   04668 TNF signaling pathway
    287398 (Map2k4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    287398 (Map2k4)
   04664 Fc epsilon RI signaling pathway
    287398 (Map2k4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    287398 (Map2k4)
   04926 Relaxin signaling pathway
    287398 (Map2k4)
   04935 Growth hormone synthesis, secretion and action
    287398 (Map2k4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    287398 (Map2k4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    287398 (Map2k4)
   05135 Yersinia infection
    287398 (Map2k4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    287398 (Map2k4)
   05161 Hepatitis B
    287398 (Map2k4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    287398 (Map2k4)
   05169 Epstein-Barr virus infection
    287398 (Map2k4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    287398 (Map2k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    287398 (Map2k4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     287398 (Map2k4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE7 family
   287398 (Map2k4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 287398
NCBI-ProteinID: NP_001025194
RGD: 1307040
Ensembl: ENSRNOG00000003834
UniProt: Q4KSH6
Position
10q24
AA seq 397 aa
MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLNFANPPVKSTARFTLN
PNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHK
PSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMS
TSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGN
IKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELAT
GRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELL
KHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggtggcggcaccccgggg
cccatcgggcctccagcttctggccacccggcggtcagcagcatgcagggtaaacgcaaa
gccctgaagttgaattttgcaaatccacctgtcaaatcgacagcacggtttactctgaat
cctaataccacaggagtccagaacccacacatagagagactgagaacccacagcattgag
tcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagaggacttg
aaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtccacaaa
ccaagtgggcagataatggcagttaaaagaatacgatcaactgtggatgaaaaagaacaa
aaacaacttctcatggatttggatgtagtgatgcggagtagtgattgcccatacattgtt
cagttctatggtgcactcttcagagagggcgactgttggatctgtatggagctcatgtct
acctcgttcgataagttttacaaatatgtatatagtgtgttagatgatgtgatcccggaa
gagatcttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaaaac
ttgaaaattattcacagagacatcaaaccttccaatattcttctggacaggagtggaaat
ataaagctctgtgacttcggcatcagtggacagctcgtggactctattgccaagacgaga
gatgctggctgtaggccgtatatggcacctgaaagaatagacccaagtgcatcaagacaa
gggtatgatgtccgctctgatgtctggagtttggggatcacattgtacgagttggccaca
ggccgatttccttatccaaagtggaatagtgtatttgatcagctaacacaagtggtgaaa
ggagaccctccccagctgagtaattccgaagaaagggagttctcccccagtttcatcaac
tttgtcaacttgtgccttacgaaggacgagtccaaaaggccaaagtacaaagagcttctg
aaacatccctttattttgatgtatgaagaacgtactgtagaggtcgcatgctatgtttgt
aaaatcctggatcagatgccagctactcccagctctcccatgtatgtcgactga

DBGET integrated database retrieval system