KEGG   Rattus norvegicus (rat): 287422
Entry
287422            CDS       T01003                                 

Gene name
Per1
Definition
(RefSeq) period circadian protein homolog 1
  KO
K21944  period circadian protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
rno04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    287422 (Per1)
   04713 Circadian entrainment
    287422 (Per1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    287422 (Per1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    287422 (Per1)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 287422
NCBI-ProteinID: NP_001029297
RGD: 727863
Ensembl: ENSRNOG00000007387
UniProt: Q8CHI5
Position
10
AA seq 1293 aa
MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGV
LLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPVPSPAP
SLDSDIQELSEQIHRLLLQPVHSSSTTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVA
PAPDQASLALAPEEPERKESSGCSYQQINCLDSILRYLESCNIPNTTKRKCASSSCTASS
ASDDDKQRAGPVPVGAKKDTSSAVLSGEGATPRKEPVVGGTLSPLALANKAESVVSVTSQ
CSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTKA
VLSLHTQKEEQAFLSRFRDLGRLRGLDTSSVAPSAPGCHHGPIPSGRRHHCRSKAKRSRH
HQTPRPETPCYVSHPSPVPSSGPWPPPPATTPFPAVVQPYPLPVFSPRGGPQPLPPAPTS
VSPATFPSPLVTPMVALVLPNYLFPSPTSYPYGVSQAPVEGPPTPASHSPSPSLPPPPPS
PPHRPDSPLFNSRCSSPLQLNLLQLEESPRTEGGAAAGGPGSSAGPLPPSEESAEPEPRL
VEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSAS
ITRSSQSSHTSKYFGSIDSSEAEAGAAQARTEPGDQVIKYVLQDPIWLLMANADQHVMMT
YQVPSRDAASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPQALDVTACVD
CGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGVGGGGGGVGGGGGDGGEEAQTQIG
TKGSSSQDSAMEEEEQGGSSSSPALPAEENGTS
NT seq 3882 nt   +upstreamnt  +downstreamnt
atgagcggtcccctagaaggggctgatgggggaggagaccccaggcccggagaacctttt
tgtcctggaggagttccatcccctggggccccacagcatcggccttgtccaggccctagc
ctggctgatgacactgatgcaaacagcaatggctcaagtggcaatgaatccaatggacac
gagtccaggggtgcatctcagcggagttctcacagttcatcttctggcaatggcaaggac
tcagctctgctggagaccactgagagcagcaagagtacaaactcacagagcccatcccca
cccagcagctccattgcctatagtctcctgagtgcaagctcagagcaggacaacccgtct
accagtggctgcagcagtgaacagtcagctcgagccaggacccagaaagaactcatgacc
gcacttcgggagctcaaacttcggctgccaccagagcgtcggggaaagggccgctctggg
accctggccacactccagtatgctctggcctgtgtcaagcaggtgcaggctaaccaggaa
tattaccagcagtggagcctggaggagggtgagccctgtgccatggacatgtctacttac
accctggaggaattggagcatatcacatctgaatacactctccgcaaccaggataccttc
tcggtggctgtgtccttcctgacaggccggattgtctatatttcggagcaggcaggtgtc
ttgctgcgttgcaaacgggatgtgtttcggggtgctcgcttctcagagctcctagctccc
caggatgtgggtgtcttctatggctctactacaccatctcgcctgcccacctggggcact
ggcacctctgcaggttcaggcctcaaggacttcacccaggaaaagtctgtcttctgccga
atcagaggagggcctgaccgggatccagggcctcgctaccagccattccgcctaacccca
tatgtgaccaagattcgtgtctcagatggggcccctgcacagccgtgctgcctgctcatt
gcagagcgcatccactctggttatgaagctccccggattcctcctgacaagaggatcttc
accacacggcacacaccaagttgcctcttccaggatgtagatgaaagggctgccccactg
ctgggttacctaccccaggatctcctgggggctccggtacttctctttctacatcctgag
gaccgacctctcatgctggccattcataagaagattctgcagttggcaggccagcccttt
gaccactcccctattcgattttgtgctcggaatggggaatatgtcaccatggataccagc
tgggccggctttgtgcacccctggagccgcaaggtggctttcgtgctgggccgccataaa
gtgcgcacggcacccctgaatgaggacgtcttcacacccccagttcccagtccagctccg
tccctggactctgatatccaggagctctcagagcagatccatcgattgctgctgcagcca
gtgcacagctccagcaccacggggctctgtggagttggccctctgatgtcccctggtcct
ctccacagccctggctcctccagtgatagcaatgggggtgatgctgaggggcctgggcct
cctgctccagtgactttccagcagatctgtaaggatgtgcatctggtaaagcaccaggga
caacagctcttcattgagtcccgggccaagcctccgccccggccccgcctccttgctaca
ggtacattcaaggccaaagtccttccctgccagtccccaaacccggaactggaggtggcc
cctgctcctgaccaagcctcattagcattggcccctgaggagccagagaggaaagagtcc
tctggctgctcctaccagcaaatcaactgcctggacagcatcctcaggtatttggaaagc
tgcaacattcctaacacaaccaagcgtaaatgtgcctcctcttcctgcacggcctcttca
gcctctgatgatgacaagcagagggcgggtccagttcctgtgggggccaagaaagatacg
tcgtcagcagtgctgtctggggagggggcaactcctcggaaggagccagtggtgggaggc
accctgagcccgctcgccctggccaataaggcagagagcgtggtgtccgtcaccagtcag
tgtagcttcagctccaccatcgtccatgtgggagacaagaagcccccggagtcggacatc
atcatgatggaagacctgcctggcctggcccctggtccagcccccagtccagcccccagc
cccacagtagcccctgacccagccccagatgcttatcgcccagtgggtctgaccaaggcc
gtgctgtccctgcacacccagaaggaagagcaagccttcctcagccgcttcagagacctc
ggcaggcttcgtgggcttgacacctcttctgtggcgccttcagcccctggttgccaccat
ggccccattccctctggtcgccgacaccactgccgatctaaagcaaagcgttctcgccac
caccagaccccccgacccgaaaccccctgctatgtgtctcatccttcacctgtgccctct
tctggaccctggccacccccaccagccactacccccttcccagcagtggtccagccctac
ccactcccagtgttctcccctcgaggaggaccccagccgcttcctcctgcccccacatct
gtgtcacctgctaccttcccttctcccttagtgaccccaatggtggccttggtgctccct
aactatttattcccttccccaactagttacccatatggggtatcccaggctcctgttgag
gggccacctacacctgcttcccactcaccttctccatccctacccccaccacctcccagc
cccccccaccgcccagactccccactgttcaactcaagatgcagttccccactccagctc
aatctgctgcagcttgaggagtccccccgcactgaagggggtgctgctgcaggaggcccc
ggaagtagtgctgggcccctgcctcccagtgaggagtctgctgagccagagcccagactg
gtggaggtcacggagtcatccaatcaggatgcactttcaggctccagtgacctgctagag
ttactgctccaggaggactctcgctctggcacaggctccgcagcctcgggctccctgggc
tccggcctgggctctgggtctggttcgggatcccacgaagggggaagcacctcagccagc
atcactcgcagcagtcagagcagccatacaagcaagtactttggcagcatcgactcttca
gaggctgaagctggagctgctcaggccaggactgagcctggggaccaggtcattaagtat
gtgctccaggatcccatctggctgctcatggccaacgctgaccagcatgtcatgatgacc
taccaggtgccgtccagggatgcagcgtctgtgctgaagcaagaccgggagaggctccgg
gccatgcagaaacaacagccacggttctcagaggaccagcggcgggaactgggtgctgtg
cactcctgggtccggaagggccagctgcctcaggccctcgatgtaacggcttgtgtggac
tgtggtagcagtgttcaagatcctggccactcggacgaccctctcttctcagaactggat
ggattggggctggagcctatggaagagggtggaggcgagggaggtggtgttggcgggggt
ggaggtggtgttggcgggggtgggggtgatggtggtgaggaggcccagacccaaattggg
actaagggctcaagctctcaggactctgccatggaggaagaagaacaaggtgggagctct
tccagtccagctttacctgcagaagagaatggcaccagctag

KEGG   Rattus norvegicus (rat): 63840
Entry
63840             CDS       T01003                                 

Gene name
Per2
Definition
(RefSeq) period circadian protein homolog 2
  KO
K02633  period circadian protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
rno04713  Circadian entrainment
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    63840 (Per2)
   04713 Circadian entrainment
    63840 (Per2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    63840 (Per2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    63840 (Per2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    63840 (Per2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    63840 (Per2)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 63840
NCBI-ProteinID: NP_113866
RGD: 61945
Ensembl: ENSRNOG00000020254
UniProt: Q9Z301
Position
9
AA seq 1257 aa
MNGYVDFSPSPTSPTQEPGEPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDSGK
ELRMLVESSNTHPSPDDTFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLRELKVHL
PADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYTMEQVEGIT
SEYIVKNSDMFAVAVSLVSGKILYISNQVAPIFHCKKDAFSDAKFVEFLAPHDVSVFHSY
TTPYKLPPWSVSSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQK
GAASQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLI
ETPVLVQLHPSDRPLMLAIHKKILQASGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWS
RKISFIIGRHKVRVGPLNEDVFAASPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGY
GSLGSNGSHEHLMSQTSSSDSNGQEESHWRRSGIFKTSGKSQSKSHFSPESGGQKEASVA
EMQSSPPAQVRSVTTMERDSSGASLPKASFPEELTYKSQPPCSYQQISCLDSVIRYLESC
NEAATLKRKCEFPANIPSRKATVSPGLHSGEAARSSKVTSHTEVSAHLSSLALPGKAESV
VSLTSQCSYSSTIVHVGDKKPQPELETVEDVASGPESQDDAAGGLSQEKGSLQKLGLTKE
VLAAHTQREEQGFLQRFREVSRLGALQAHCQNYLQERSRAPASDRGLRNASGIESSWKKT
GKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLVGLNATAWSPSDTSQSSCPSAPFPAPVP
AYPLPVFPAPGIVSTPGTVVAPPAAAHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAF
MLPSYPFPPATPNLPQAFFPSQPHFPAHPTLASEITPASQAEFPSRTSMLRQPCACPVTP
PAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPESSTGAAGTLGTTGTAASGLDCTSGA
SRDRQPKAPPTCSEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLG
SSSLGCDTSRSGAGSSDTSHTSKYFGSIDSSENNHKAKMITDTEESEQFIKYVLQDPIWL
LMANTDDNIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPHFTEGQRRELREVHPWVHTGG
LPTAIDVTGCVYCESEEKGNLCLPYEEDSPSLGLCDTSEAKEEESGQLANPRKEAQT
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgaatggatatgtggacttttccccaagtcccaccagccccacccaagagccaggggag
cctcaacccacccaggctgtgctccaggaagacgtggacatgagcagcggctccagcgga
aatgaaaactgctccacggggcgggactctcagggcagtgactgtgacgacagtggaaag
gagctgcggatgttagtggaatcgtccaacactcaccccagccctgacgataccttcaga
ctcatgatgacagaggcggagcataacccctccacaagcggctgcagtagtgagcagtct
gccaaagctgacgcacacaaagagctgataaggaccctgagggagctgaaggtccacctc
cctgcagacaagaaggccaaggggaaggccagcacgctggcaaccttgaagtacgctctg
cggagcgtgaagcaggtgaaggctaatgaggagtactaccagctgctaatgtccagtgag
agccagccctgcagcgtggatgtgccttcctacaccatggagcaggttgagggcattacc
tccgagtatattgtgaagaactcggacatgtttgctgtggctgtgtccctggtctctggg
aagatcctgtacatctccaaccaagtcgcccccatctttcactgtaagaaggacgccttc
agtgatgccaagtttgtggagttcctggctccccatgacgtcagtgtgttccacagctac
accaccccttacaagcttccgccctggagtgtgagcagtggcttagattctttcactcag
gagtgcatggaggagaaatcttttttctgccgtgtcagtgttgggaaacaccacgagaat
gagattcgctaccagcccttccgcatgacaccctacctggtcaaggtgcaagagcagaag
ggcgctgcgagccagctctgctgcctgctgctagcagagagggtacactcaggctatgaa
gctcctagaattcctcccgagaagagaattttcacaacaacccacacaccaaactgcctg
ttccaggatgtggacgaaagggcggtccccctcctgggctatctacctcaggatctgatc
gagacccctgtgctcgtgcagctccaccccagcgaccggcccttgatgctcgccatccac
aagaagatcctacaggccagtgggcagcctttcgattattctcccattcgattccgcaca
cgcaacggggagtacatcacactggacactagctggtccagcttcatcaacccgtggagc
aggaagatatccttcatcatcgggaggcacaaagtcagggtaggccctttgaatgaggat
gtgttcgcagcctccccttgcccagaggagaagactccgcaccccagcgttcaggagctc
acagagcaaatccaccggctactgatgcaacctgtcccccacagcggctccagtggctat
gggagcctgggcagtaacggatcccacgaacacctcatgagccagacatcatccagcgac
agcaatggtcaagaggagtctcactggaggagatccggaatttttaaaaccagtggcaag
agtcaaagcaaaagtcacttttctcctgagtctggaggacaaaaggaagcctctgttgca
gaaatgcaaagtagtcctccagctcaggtgaggtctgtcaccaccatggaaagggacagc
tcgggggccagcctacccaaggctagctttccagaggaactaacctataagagccagcct
ccttgctcctaccagcagatcagctgcctggacagtgtcatcaggtacctggagagctgc
aacgaggcagccaccctgaaaagaaagtgcgagttcccagccaacatcccatcccggaag
gccacggtcagccctgggctgcactctggagaggcagcgcggtcctccaaggtgaccagc
cacacggaggtcagtgctcacttgagctccttggcgttgccgggcaaggccgagagtgtg
gtgtccctcaccagccagtgcagctacagcagcaccatcgtgcacgtgggcgacaaaaag
ccacagcctgaactagagacagtagaagatgtggccagtgggcctgagtcccaggatgat
gcagctggtggcctcagccaagaaaaggggtctctgcagaagctaggcctcaccaaggaa
gttctggctgcacatacccagagagaggaacagggcttcctgcagaggttcagggaagtg
agcaggctcggtgccctgcaggctcactgccagaactatctccaggagcggtcccgagcc
ccagcaagtgatcgaggactaagaaatgcttctggaatagaatcatcttggaaaaaaact
ggaaagaacaggaaactgaagtccaagcgtgtcaagactcgagactcttctgagagcaca
gggtctgggggacccgtgtcccaccgacctcccctcgtgggcctgaatgccacagcctgg
tcgccctctgacacatcccagtctagctgtccctctgcaccattccctgctccagtgcca
gcttacccactacctgtgttcccggcacctggaatagtatccacaccagggacggtggtg
gcaccacctgcagccgcccacaccggcttcaccatgcctgttgtgcctatgggcacccag
cctgaattcgcagtgcagcccctgccgttcgctgcccccttggctccggtcatggccttc
atgctacccagctacccgtttccaccagcaaccccaaacctgcctcaggccttcttcccc
agccagcctcactttccggcccatcccacacttgcctctgaaataactcctgcctcccag
gctgagttccctagtcggacctcgatgctcaggcagccatgtgcttgcccagtcaccccc
ccggctggcacagtggccttgggcagagcctccccgccactcttccagtcccgaggcagc
agtcccctacagcttaacctgcttcagctagaggaagcacctgaaagtagtactggagct
gcagggaccttggggaccacggggacagcagcttctggtctggactgcacatctggcgca
tctcgggaccggcagccaaaggcacctccaacatgcagtgagccctcagacacccagaac
agtgatgccatctccacctccagtgacctgctcaacctcctcctgggcgaggacctctgc
tcagccaccggctcagcactgtcgagaagcggggcatctgccacctcagactcactgggc
tccagctccctgggctgtgacacatcccggagtggggcaggcagcagtgatacaagtcac
accagcaaatactttggaagcattgactcttcagagaataatcacaaagcaaaaatgatc
acagacacggaggagagtgaacagttcattaagtacgtcttgcaggaccccatctggctg
ctgatggccaacacagacgacaatatcatgatgacataccagctgccctcccgggatctc
caggcggtcttgaaagaggaccaggagaagctgaagctgctgcagaggtcccagccccac
ttcacggagggccagaggcgagagcttcgagaggttcatccgtgggtccacaccgggggt
ctgcctaccgccatcgacgtaacagggtgtgtttactgtgaaagtgaggagaaaggcaac
ctttgtctgccatatgaggaagacagtccttccctgggactctgtgatacctcagaagcc
aaagaggaggagagcggacagctggccaatcctaggaaggaggcccagacgtaa

KEGG   Rattus norvegicus (rat): 78962
Entry
78962             CDS       T01003                                 

Gene name
Per3
Definition
(RefSeq) period circadian protein homolog 3
  KO
K21945  period circadian protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
rno04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    78962 (Per3)
   04713 Circadian entrainment
    78962 (Per3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    78962 (Per3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    78962 (Per3)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 78962
NCBI-ProteinID: NP_076468
RGD: 621581
Ensembl: ENSRNOG00000018413
Vega: OTTRNOG00000002317
UniProt: Q8CJE2 G3V8D9
Position
5
AA seq 1115 aa
MDPCGNPAVPGGDCPQTRGPGLQGSSGQEGPLQGICVDSSHSEHEDRNRMSEELIMVVQE
MKKYFPAERHTKPSTLDALNYALRCVHSVQANSEFFQSLSPRGARQAEATVYNLEELTSL
ASEHTSKNTDTFVAVFSFLSGRLVHISEQAAWILNSKKGFLKSLHFVDLLAPRDVRVFYA
HTAPTQLPFWNTWTQRASQYECAPVKPFFCRICGGGDREQKRHYSPFRILPYLVHVHSPA
QPEPEPCCLTLVEKIHSGYEAPRIPVDKRVFTTTHTPGCVFLEVDERAVPLLGFLPQDLI
GTSILTYLHPEDRPLMVAVHQKVLKYVGHPPFEHSPIRFCTQNGDYVILDSSWSSFVNPW
SRKVSFIIGRHKVRTSPLNEDVFATRIKKATSHDEDITELQEQIHRLLLQPVHASASSGY
GSLGSSGSQEQHISVTSSSESSGHCVEEAQQEQMTLQQVYASVNKIKNVGQQLYIESMAR
SSVKPVMETCTEPQGSDEQKDFSSSQTLKNKSTDTGSGGDLRPEQHSSSYQQMNCIDSVI
RYLTSYSFPALKRKCISCTNTSSSSEEAKPNPEADGSLRDTEQLLDIPEQETTAPSADAE
GGVARTLSTAALSMASGVSQCSCSSTTDHVPPLQSESVAGACEPWALRTKAHVTAEGFKP
VGLTAAVLSAHTQKEEQNYVDRFREKILTSPYGCYLQQEGRNHAKYACVVGAGATPKHSR
CAGSERRKHKRKKLPTPVDSSSSSAHLCPHVRGLLPDVQHWSASVTSPCATGLALPSALV
VPSQTPYLLSSFPLQDMAPQGVGDSAAWGAAAECPPLSAGPQPVSTFPSAYMGTFMTVLL
HNSPLFPLWPASFSPYPFLGATGPSQMAPLVPAMAPDLEPTPSDHGPRRVEENWETHSEE
EHPFISSRSSSPLQLNLLQEEMPAPSEYADAVRRGACPDAKQLCVTGNSGSRSPPCATGE
LATASVQQESSSAAASGSSASSVHGSGSDYTSEVSENGQRSQDRQRDRAFSGAAEESIWR
MIERTPECVLMTYQVPERGRDTVLREDLEKLHSMERQQPQFSSAQKEELAKVRSWIHSRP
APEERQLQSYVTCENRGSVGDTAEACEQCPAEDTS
NT seq 3348 nt   +upstreamnt  +downstreamnt
atggatccctgtggaaacccggcagtgcctggtggcgactgtccccaaactaggggaccg
gggctccaagggtcgtctggccaggagggtcctctgcagggcatttgcgtggacagcagc
cacagtgaacatgaagaccgaaacagaatgtctgaagagcttataatggttgtccaagaa
atgaaaaagtatttcccagccgagagacacactaaacccagcaccctagatgcccttaac
tatgccctacgctgtgtacatagtgtgcaagcaaacagtgaatttttccagagtctcagt
ccacgtggagcacgtcaggcagaagcgactgtatataatctcgaggagctgacctctctg
gcttctgaacatacttccaagaacacagataccttcgtggcagtgttttcgtttctgtct
ggaaggctggtgcacatttctgaacaggctgcttggatcctgaattctaagaaaggtttc
ctcaagagcttgcacttcgtcgacctgcttgcccctcgggacgtgagggtgttctacgct
cacaccgctccaactcaactccctttctggaacacctggacccaaagagcctcgcagtat
gaatgcgcaccagtgaagccctttttctgcagaatctgtggcggtggagacagggagcag
aagagacattactccccattccggatcctcccctacttggttcatgtacacagccctgcc
cagccagagccagagccttgctgtctaacactggttgaaaagattcactctggttatgaa
gctcctcgaatccctgtagataaaagagtttttaccacaacacacacgccgggatgtgtg
tttcttgaagtagatgaaagagcagtgcctttgctgggtttcctacctcaggatctgatt
ggaacgtcgatcttaacgtacttgcacccagaagatcggcctctgatggttgcagtacac
caaaaagttttaaagtacgtgggccaccctccatttgaacactcacccataagattctgc
acgcagaatggagattatgtcattctggattccagctggtccagctttgtgaacccctgg
agccggaaggtctccttcatcattggtcgacataaagtccgaacgagcccgttaaatgaa
gatgtttttgccaccagaataaaaaaggcaaccagtcatgacgaagacataacagaatta
caagaacaaattcacagacttctcttgcagccggttcatgccagtgcttccagtggctac
gggagcctgggcagcagtggctcgcaggagcagcacatcagcgtcacctcttccagtgag
tcaagcggacactgtgtggaggaagcccagcaggagcagatgaccctgcagcaggtctat
gccagtgtaaacaaaattaagaatgtgggccaacagctctacatcgagtcgatggccaga
tcgtcggtgaagccagtgatggagacgtgcacggaaccgcagggtagtgatgagcagaag
gacttttcttcctctcagacactgaaaaataaaagcacagataccggctctggaggcgat
ctgcggccagagcagcatagctcgtcctatcagcagatgaactgcatcgacagtgtcatc
aggtacctgacaagctacagtttcccagccttgaaaagaaagtgcatctcctgcacaaac
acgtcttcatcctcagaggaagccaagccaaacccagaggcagacggcagcctgcgagac
accgaacagctcctggacattccagaacaggaaacaaccgcaccatccgcagacgccgag
ggaggtgttgcacggaccctgtccactgccgcactgagcatggcgtctggcgtaagccag
tgcagctgcagcagcaccacggaccacgtcccccccctacagtcagaaagtgttgccgga
gcgtgtgagccctgggccctgagaacgaaggctcacgtgaccgcagaaggattcaagccc
gtggggctcacagcggccgtcctctccgcgcacacgcagaaggaagagcagaactatgtt
gacaggttccgggagaagatcctgacctcgccctacggctgttatcttcagcaagaaggc
aggaaccatgccaagtacgcctgcgtcgtcggagcaggggccacccctaagcacagcaga
tgtgctggaagtgagagacggaagcacaaacggaagaagctgccgacgcctgtggacagc
agcagctccagtgcccacctctgtccccatgtcagaggactccttccagatgtgcagcac
tggagcgcttccgttacctctccctgtgctacaggcctagctctcccctcagccctggtg
gttcccagccagaccccgtatctcctctcctcttttccccttcaagacatggcccctcag
ggagtaggggactccgcagcctggggtgctgcagccgagtgtccacctctgtccgctggt
ccccagcctgtttccacgttcccttctgcttacatgggtactttcatgaccgtcctcctg
cacaacagccctctctttcctctgtggccggcatcattctctccatatccattcctgggg
gccacaggtccttctcaaatggcacccttagtaccagcaatggctccagacctggaacca
accccttcagaccacggcccaaggagagtggaggagaactgggagacacacagcgaagaa
gagcatccgtttattagctcacggagcagttcaccattgcagttaaatttactccaggaa
gaaatgcctgcaccatcagagtatgcagatgcagtgagaagaggcgcctgcccagacgct
aagcaactctgtgttacaggtaacagtggcagtaggagccctccctgtgccacaggtgag
ctggccacagcatcagtacagcaagaatcttcatccgcagctgcctcaggaagcagtgcc
agcagtgtacacggcagtggcagtgactacacttctgaagtctctgaaaatggacagagg
tcacaggatagacagagagacagagccttttccggggcggctgaagaatctatctggaga
atgatagaacggacgccagagtgtgttctcatgacataccaggtgccggagaggggtaga
gacacggtgctgagggaagacctggaaaaacttcacagcatggagcggcagcagccccag
ttctcttctgcgcagaaggaggagctggccaaggtgcggtcctggatccacagccgccct
gcccctgaggaaagacagctccaaagctatgtcacctgtgaaaacagaggttcagttggt
gacactgcagaggcctgtgaacagtgtccagcagaagacaccagttga

DBGET integrated database retrieval system