KEGG   Rattus norvegicus (rat): 287424
Entry
287424            CDS       T01003                                 

Gene name
Aloxe3, e-LOX-3, eLOX-3
Definition
(RefSeq) arachidonate lipoxygenase 3
  KO
K18684  hydroperoxy icosatetraenoate dehydratase/isomerase [EC:4.2.1.152 5.4.4.7]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    287424 (Aloxe3)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.152  hydroperoxy icosatetraenoate dehydratase
     287424 (Aloxe3)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.7  hydroperoxy icosatetraenoate isomerase
     287424 (Aloxe3)
SSDB
Motif
Pfam: Lipoxygenase PLAT DUF2685
Other DBs
NCBI-GeneID: 287424
NCBI-ProteinID: NP_001099263
RGD: 1306252
Ensembl: ENSRNOG00000007454
UniProt: D3ZKX9
Position
10q24
AA seq 711 aa
MAVYRLCVTTGSYLKAGTLDNIYATLVGTCGESPKQKLDRVGRDFATGSVQKYKVRCASE
LGEILLLRLHKERFAFFCKDPWYCSRICVTTPDGSVVHFPCYQWIDGYCTVELRPGTART
ICQDALPLLLDHRKRELQARQECYRWKIYAPGFPRMVDVSSFEEMESDKKFALTKTAPCA
DQDDNSGNRYLPGFPMKVDIPSLLHMEPNIRYSATKTASLIFNALPASLGMKIRGLLDRK
GSWKRLDDIRNIFWCHKTFTSEYVTEHWCEDSFFGYQYLNGVNPIMLHCLSSLPSKLPVT
NDMVAPLLGPGTCLQTELERGHIFLADYWILAEAPVHCLNGRQQYVTAPLCLLWLNPQGV
LLPLAIQLSQIPGPESPIFLPTDCELDWLLAKTWVRNSEFLVHENNTHFLCTHLLCEAFS
MATLRQLPLCHPVYKLLLPHTRYTLQVNTIARATLLNPDGLVDKVTSIGRRGLIYLMSTG
LAHFTYTDFCLPDSLRARGVLTIPNYHYRDDGLKIWAAIERFVSEIVSYYYPNDACVQQD
SELQAWVGEIFAQAFLGRESSGFPSRLCTPGELVKYLTAIIFNCSAQHAAVNSGQHDFGA
WMPNAPSSMRQPPPQTKGNTTMESYLETLPEVNTTCSNLLLFWLVSQEPKDQRPLGTYPD
EHFTEEAPRQSIAAFQKCLAQISKDIRARNESLALPYAYLDPPLIENSVSI
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggcagtatatcgcctgtgtgtgaccactggttcctacctgaaggctggcacattggat
aacatctatgctacactggtaggcacctgtggtgaaagccctaagcagaagctggatcgt
gtaggcagggacttcgccaccggatcggttcagaagtacaaggtgcgctgtgcatcagag
ctgggtgagatcttgctgttgcgcttacacaaggagcgctttgctttcttctgcaaggat
ccttggtactgcagtcgcatctgtgtcactaccccagatggctctgtggttcactttccc
tgttatcagtggatcgatggctactgtactgtggagcttcggccaggaacagcaagaacc
atctgccaggatgctcttcccctccttctggatcacaggaagcgtgaactccaagcccgc
caagaatgctaccgctggaagatctatgcccctggtttccctcgaatggtggatgtcagc
agctttgaggagatggagtcagataagaaatttgccttgaccaagacggcgccttgtgca
gaccaggatgataactctgggaaccggtacctgcctggctttcctatgaaagttgacatc
ccatctctgctgcacatggagcccaacattcgctactcagccaccaagacagcctcactc
atcttcaacgcccttcctgcatccttgggcatgaagattcgaggtctgctagaccgcaag
ggctcctggaagaggctggatgacatccggaacatcttctggtgtcataagaccttcact
tcagagtatgtcaccgagcactggtgtgaggacagcttctttgggtaccagtacctgaac
ggtgtcaatcccatcatgctccactgcctctccagtctgcccagcaagctgcctgtcacc
aatgacatggtggcacctttgctgggacccggcacctgcctgcaaacagagctagagagg
gggcacatcttcttagcggactactggatcctggcggaggccccagtccattgcctaaac
ggccgccaacagtacgtaacagctcctctctgcctgttatggctcaacccacagggggtg
ctgctgccgttggcaatccagctcagccagataccagggccagagagccccatctttcta
cccactgactgcgagttggattggctgctggccaagacgtgggtgcgcaactctgagttt
ttggtgcatgagaacaacacgcattttctgtgcacgcatttgctctgcgaggccttctcc
atggctacactgcgtcagctgcccctctgtcatccagtctacaagctcctgcttcctcac
actcgctacacactgcaagtgaacaccatcgcaagggccacactgctcaacccagacggc
ctcgtggacaaggtcacatccatcggtaggcgcggcctcatctacctcatgagcacaggg
ctggcccacttcacctacacggatttctgccttccggatagcctacgggctcgtggtgtc
ctgaccattcccaactaccactaccgagacgacggcctcaagatctgggcggctattgag
aggtttgtctccgagattgtgagttactattaccccaacgatgcctgtgtgcagcaggac
tctgagctgcaggcctgggtgggtgagatttttgctcaggcattcctcggtcgggagagt
tcaggcttcccaagcaggctgtgcaccccaggagagctcgtgaagtatctcactgcaatc
atctttaactgctccgcccagcacgctgcagtcaacagtgggcagcacgactttggggcc
tggatgcccaatgccccgtcatccatgaggcagcctccacctcagaccaagggcaacacg
acaatggagagttacctcgaaaccctcccagaggtgaacaccacctgtagcaaccttctc
ctcttctggctggtcagccaagagccaaaggaccagaggcctctgggcacctacccagac
gaacacttcacagaggaggccccacggcaaagcatcgcagccttccagaagtgcctggca
cagatctcaaaggacatcagggcacgcaacgagagcctggcactaccctatgcctacttg
gatccaccactcattgagaacagtgtctccatctag

DBGET integrated database retrieval system