KEGG   Rattus norvegicus (rat): 287429
Entry
287429            CDS       T01003                                 

Gene name
Naa38, Lsmd1, RGD1559617
Definition
(RefSeq) N(alpha)-acetyltransferase 38, NatC auxiliary subunit
  KO
K20824  N-alpha-acetyltransferase 38, NatC auxiliary subunit
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287429 (Naa38)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   N-acetyl transferase complex C (NatC)
    287429 (Naa38)
SSDB
Motif
Pfam: LSM FAM194
Other DBs
NCBI-GeneID: 287429
NCBI-ProteinID: NP_001099264
RGD: 1559617
Ensembl: ENSRNOG00000009823
UniProt: G3V785
Position
10q24
AA seq 125 aa
MAGAGPTMLLREENGCCSRRQSSSSAGDSDGEQEDSPAARARQQLEALLNKTMRIRMTDG
RTLVGCFLCTDRDCNVILGSAQEFLKPSDSFSAGEPRVLGLAMVPGHHIVSIEVQRESLS
GGPYL
NT seq 378 nt   +upstreamnt  +downstreamnt
atggccggagctgggccgaccatgctactacgagaggagaatggctgttgcagtcggcgt
cagagcagctccagcgccggggactctgatggggaacaggaggactcgcctgcagcgcgt
gcccggcagcagctagaggcattgctcaacaagaccatgcgtattcgtatgacagacgga
aggacactagtcggctgcttcctgtgcaccgatcgtgactgtaatgtcatcctgggctct
gcgcaagaattcctcaagccttctgattcattttctgcgggggaaccccgtgtgctgggt
ctcgccatggtaccaggacaccacatcgtttctattgaagtccaaagggagagtctgtcg
gggggcccgtatctctga

DBGET integrated database retrieval system