KEGG   Rattus norvegicus (rat): 287437Help
Entry
287437            CDS       T01003                                 

Gene name
Tnfsf13, April, Tnlg7b
Definition
(RefSeq) tumor necrosis factor superfamily member 13
  KO
K05475  tumor necrosis factor ligand superfamily member 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04672  Intestinal immune network for IgA production
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287437 (Tnfsf13)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    287437 (Tnfsf13)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    287437 (Tnfsf13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    287437 (Tnfsf13)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    287437 (Tnfsf13)
   04090 CD molecules [BR:rno04090]
    287437 (Tnfsf13)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     287437 (Tnfsf13)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   287437 (Tnfsf13)
CD molecules [BR:rno04090]
 Proteins
  287437 (Tnfsf13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF LapA_dom
Motif
Other DBs
NCBI-GeneID: 287437
NCBI-ProteinID: NP_001009623
RGD: 1305871
Ensembl: ENSRNOG00000014171
UniProt: Q5PQL1
Position
10q24
AA seq 240 aa AA seqDB search
MPASSPGNMGGSVREPALSVTLWLSWGAVLGAVTCAVALLIQQAELQSLRREVSRLQRSG
GASQKRGEPPWQSLWEQSPDVLGAWKDGAKSRRRRAVLTQKHKKKQSVLHLVPINITSKD
SDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRR
ETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgccagcctcatctccaggcaacatgggaggctcagtcagagagccagccctttcggtc
actctttggttgagttggggggcagttctgggggctgtgacttgtgctgtcgcactactg
atccaacaagcagagttgcagagcctaaggcgggaggtgagccggctgcagcggagtgga
ggagcttcccagaagcggggagagcctccatggcagagcctctgggaacagagtcctgat
gtcctgggagcctggaaggatggggccaaatctcggagaaggagagcagtactcacccag
aagcacaagaagaagcagtccgttctgcatcttgttccaattaacattacctccaaggac
tctgacatgacagaggtgatgtggcaaccagctcttaggcgtgggagaggcctggaggcc
caaggagacactgttcgagtccgggacactggaatttatctgctatatagtcaggtcctg
tttcatgatgtgactttcaccatgggtcaggtggtatctcgggaaggccaagggagaagg
gagactctattccggtgtatcaaaagtatgccttctgatcctgaccgtgcctacaacagc
tgctacagtgcaggtgtctttcacttacatcaaggggatattatcactgtcaaaattcct
cgggcaaacgcaaaacttagcctttctccacatggaacattcctggggtttgtgaaacta
tga

DBGET integrated database retrieval system