KEGG   Rattus norvegicus (rat): 287457
Entry
287457            CDS       T01003                                 

Gene name
Zmynd15
Definition
(RefSeq) zinc finger, MYND-type containing 15
  KO
K24081  zinc finger MYND domain-containing protein 15
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    287457 (Zmynd15)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     287457 (Zmynd15)
SSDB
Motif
Pfam: zf-MYND
Other DBs
NCBI-GeneID: 287457
NCBI-ProteinID: NP_001099270
RGD: 1309845
Ensembl: ENSRNOG00000019477
UniProt: D4A1E1
Position
10q24
AA seq 738 aa
MEFVSGYRDEFLDFAALLFGWFRKFVAERGTMGTSLEGRWRQLESQIRRLPQDPALWVLH
VLPNRSVGISLGQGAEPGPGPGLGASRLLGDEPPLHLRDLSPYVSFVSLEDGEEGEEEEE
EEEEEHGEERPGTEKVELQEGGEPAPPSKELPQEVKPAQESEVTQQEASCDEGCREERAE
DERAPEKRKGRKTEAAPLHLSCLLLVTDEHGTILGIDLLMDGAQGSVGQSPGTENLAPRA
YALLCHSMACPMGSGDPRKPRQLTVGDAHLHRELESLVPRLGVKLAKTPMRTWGPRPGFT
FASLRARTCHVCHKHSFEVKLTPCPQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLAA
FMERAGELASLPFTYTAEVTSETFNKEAFLASRGLTRGYWTQLSMLIPGPGAPRNPWGTT
PSLSCLLNGDPYQLLQGDGPALMPPVPLDPPRSLFGSWQDYYTWRGLSLDSPVAVLLTYP
LTVYYVITHLVPQSFPELNIQNKQSLKIHVVEAGKEFDLVMVFWELLVLLPHVALELQFV
GDSLPPESDQQHITMQRDGPEASVRPGSGVSARLSSGTKEKGGRRDLQIRVSTRPYHLLQ
GPKPDLVIGFNSGFGLKDTWLSSLPRLQSLRVPAFFTESSEYGCVMDDQTMAVATGGGTS
SPQPNPFRSPFRLRAADNCMPWYCNAFIFHLVYKPPQGGTVRSAPGPAPRPPTPAAPPVP
ARRRRGEKKAARGPRRRR
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggagtttgtgtctggataccgagatgagttcctcgattttgctgctcttctctttggc
tggttccgcaagtttgtggcagagagggggaccatgggaacaagccttgagggccgatgg
cgtcaactggagtctcagataaggaggctgcctcaggaccctgccctttgggtgctccac
gttttaccaaaccgcagtgtgggcatcagcctggggcaaggtgcagagccaggtcctggg
ccaggcctaggggcttcccggctcctgggagacgaacctccacttcacctgagagacctg
agtccttatgtcagttttgtcagcctagaggatggagaggaaggggaggaggaggaggag
gaggaagaagaggagcatggagaggagagaccaggcacagagaaggtggaactgcaggag
ggtggggagccagcccctccaagcaaggaactcccccaagaagtaaagcctgctcaggag
tctgaggtgacccaacaggaggcaagctgtgatgaaggctgccgagaggagcgggcagag
gatgagagggcgcctgaaaagaggaaaggacggaagactgaggctgcccccctgcacctc
tcctgccttttactggtgacggatgagcatggcaccatcttgggcattgatctgctaatg
gacggagcccaggggagtgtaggccagagcccagggactgagaatctggcgcctcgggcc
tatgctctcctctgtcatagcatggcctgccctatgggctctggggacccccgaaagccc
cggcagcttaccgtaggagacgcccatctgcatcgagagctagagagcctggtgccaagg
ctgggtgtgaagttagcaaaaaccccaatgcggacatggggtcctcggccaggcttcacc
tttgcctcccttcgggctcgaacttgccacgtgtgtcacaagcacagctttgaagtgaag
ttgacaccctgcccccagtgcagtgctgtcttgtactgtggagaggcttgcctccaggcc
gattggcggcgatgcccagatgatgtgagccaccgattttggtgcccgaggcttgcagct
ttcatggagcgggcaggagaactggcaagtttgcctttcacctacactgcagaggttacc
agtgagacctttaacaaagaagctttcctggcctctcgaggcctcacacgtggctattgg
acccagctcagcatgctgattccagggcctggtgctcccaggaacccttggggaaccaca
ccatccctcagctgccttctcaatggtgatccttaccagcttctgcagggagatgggcct
gccttgatgcctccagtgcccctagacccacccaggagcctctttggttcttggcaggat
tactacacatggcggggccttagcctggactccccggtggctgtgcttctcacctaccca
ctgactgtgtactatgtcatcacccacctggtaccccagtccttccctgagctcaacatc
cagaacaagcagtccctaaagatccacgtggtagaggctggcaaggaattcgatctcgtc
atggtgttttgggagctcttggtccttctcccccatgtggccctggagctacagtttgtg
ggtgacagcctgccacctgagagtgaccagcagcatattactatgcagagggatggccct
gaggcctctgttcgtcctggttctggagtatcagcacggctcagctctgggactaaggag
aaggggggtcgaagagatcttcaaatcagggtgtctaccaggccctatcacctgctccag
ggacccaagcctgacctggttattggatttaactccggctttggtctcaaggacacgtgg
ctgagctctctaccccggttacagtctctccgagtgccagctttcttcactgagagcagt
gagtacggctgtgtgatggacgatcagaccatggcggtggccacaggagggggtaccagc
tcgccacagcccaaccccttccgctctccattccgccttagagcagctgacaactgtatg
ccgtggtactgcaacgccttcatcttccatttggtctacaagccaccccaaggcggcaca
gttcgctcagctcccggccctgcacctcgacccccaactccggctgctcctcctgtcccg
gctcgaaggcgccgaggagaaaagaaagctgcacgcggaccccgccggcgcagatga

DBGET integrated database retrieval system