KEGG   Rattus norvegicus (rat): 287473
Entry
287473            CDS       T01003                                 

Gene name
Nek8
Definition
(RefSeq) NIMA-related kinase 8
  KO
K20877  NIMA (never in mitosis gene a)-related kinase 8 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    287473 (Nek8)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    287473 (Nek8)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     287473 (Nek8)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NEK family
   287473 (Nek8)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    287473 (Nek8)
SSDB
Motif
Pfam: Pkinase RCC1 PK_Tyr_Ser-Thr RCC1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 287473
NCBI-ProteinID: NP_001099274
RGD: 1306897
Ensembl: ENSRNOG00000012866
UniProt: D3ZGQ5
Position
10q25
AA seq 698 aa
MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNH
PNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVH
THLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPY
NQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLS
LEPAQRPPLSHIMAQPLCIRALLNIHTDVGSVRMRRAEKCLTPGTPMAPGSTGSRATSAR
CRGVPRGPVRPAIPPPLSSVYAWGGGLSIPLRLPMPNTEVVQVAAGRTQKAGVTRSGRLI
LWEAPPLGTGGGTLLPGAVELPQPQFVSRFLEGQSGVTIKHVACGDLFTACLTDRGIIMT
FGSGSNGCLGHGSLTDISQPTIVEALLGYEMVQVACGASHVLALSADGELFAWGRGDGGR
LGLGTRESHNCPQQVPMVPGQEAQRVVCGIDCSMILTSPGRVLACGSNRFNKLGLDCLSL
EEEPVPHQQVEEALSFTPLGSAPLDRETLLCVDLGTAHSAAVTASGACYTFGSNQHGQLG
TSSRRVSRAPCRVQGLEGIKMVMVACGDAFTVAIGAEGEVYSWGKGARGRLGRRDEDAGL
PRPVQLDETHPYTVTSVSCCHGNTLLAVRSVTDEPVPP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggagaagtacgagcggatccgagtggtgggaagaggtgccttcgggattgtgcacctg
tgccttcgaaaggctgaccagaagctggtgatcatcaagcagatcccagtggaacagatg
accaaagaggagaggcaggcggcacagaatgagtgccaggtgctcaaactgctcaaccac
cccaacgtcattgagtactacgagaacttcctggaggacaaggccctcatgatcgccatg
gaatatgcaccaggtggcaccctggctgagttcatccagaagcgctgcaactccctgctg
gaggaggagacgatccttcacttctttgtgcagatcctgcttgcgctgcatcatgtgcac
acacacctcatcctgcatcgggacctcaagacccagaacatccttcttgacaagcaccgc
atggtcgtcaagatcggggactttggcatctctaagatccttagcagcaagagcaaggcc
tacacggtggtgggtactccatgctacatctcccctgagctatgtgagggcaagccctac
aaccagaagagtgacatctgggctctgggctgtgtcttatatgagcttgccagtctcaag
agggcctttgaggcagcgaacttgcccgccctggtgctgaagatcatgagcggcaccttt
gcacccatctctgaccgttatagtcctgagctacgccagcttgtcctgagtctgctcagc
ctggaacctgcacagcggccacccctcagccacatcatggctcagcccctctgcatccgg
gccctactcaacatccacaccgatgtgggcagcgtccgcatgcggagggcagagaagtgc
ctgaccccaggaacacctatggccccgggcagcacagggagcagggccaccagtgcccga
tgcaggggtgtcccccggggacctgtgagaccggccatcccgccgcctctgtcttccgtc
tacgcttggggtggtggccttagcattcccctgaggttgccgatgcccaacacggaggtg
gtccaggtggccgcagggcgcacacagaaggctggcgttacacgctcaggacgcctcatt
ctgtgggaggccccacccctgggaactggaggcggcacactccttccgggggcagtggag
ctgcctcagccccagtttgtctctcgtttcctggagggccagtcaggcgtgaccatcaag
catgtggcctgcggggacctgttcactgcttgcttgacggacagaggcatcatcatgact
tttggcagcggcagcaacgggtgtttaggtcacggcagcctgactgacatcagccagccc
accattgtagaggccctgctggggtatgagatggtgcaggtggcctgtggagcctctcat
gtgctggccctgtccgcagatggagagttatttgcctggggccgaggagatggcggtagg
ctgggactaggcaccagggagtcccataactgccctcagcaggtgcctatggtcccagga
caggaagctcagagagttgtctgtggtattgactgttccatgatcctcacctcaccaggc
agggtcctggcctgtggaagtaacaggttcaacaagctaggcttggactgcctgtccctg
gaggaggagcctgttccccaccagcaagtggaggaggccctgagcttcacgccgctgggt
tctgcacctctggaccgggagaccctgctgtgcgtggaccttggcactgctcattcagct
gctgtgactgcttccggggcctgctatacttttggcagcaatcagcatgggcaattgggc
accagttcccgccgggtcagcagggcaccctgtcgggtccaaggcctagagggcatcaag
atggtgatggtggcctgtggggatgccttcactgtggccattggggcagagggggaagtg
tattcttggggcaaaggagcccggggtcgcctgggaaggagggatgaggatgccggactc
cctagaccagtgcagctggatgagactcatccttacacggtgacatcagtgtcctgctgc
catgggaacactcttttggctgttcgatcagtcacagatgaaccagttcccccctga

DBGET integrated database retrieval system