KEGG   Rattus norvegicus (rat): 287475Help
Entry
287475            CDS       T01003                                 

Gene name
Med31, RGD1309457
Definition
(RefSeq) mediator complex subunit 31
  KO
K15153  mediator of RNA polymerase II transcription subunit 31
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    287475 (Med31)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Middle
     287475 (Med31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med31
Motif
Other DBs
NCBI-GeneID: 287475
NCBI-ProteinID: NP_001129285
RGD: 1309457
Ensembl: ENSRNOG00000014618
UniProt: D4A7J4
Position
10q24
AA seq 131 aa AA seqDB search
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKE
PEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALA
EQQQQNTTAGK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccgtcgctatggagacagatgatgctggaaatcgacttcggtttcagttg
gagttggaatttgtgcaatgtttagccaacccaaattaccttaattttctcgcccaaaga
ggttacttcaaagacaaagcttttgttaattatcttaagtacttgctttactggaaagaa
ccagaatatgccaaatatctaaagtaccctcagtgtttgcatatgttagaactgctccaa
tatgaacactttcgaaaggagctggtgaatgctcagtgtgcgaagttcattgacgaacag
cagattctgcactggcagcactattcgaggaagcggatgcgtcttcagcaagccctagca
gagcagcagcagcagaataccacagcaggaaaatga

DBGET integrated database retrieval system