KEGG   Rattus norvegicus (rat): 287478
Entry
287478            CDS       T01003                                 

Gene name
Ctns
Definition
(RefSeq) cystinosin, lysosomal cystine transporter
  KO
K12386  cystinosin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    287478 (Ctns)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    287478 (Ctns)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   287478 (Ctns)
SSDB
Motif
Pfam: PQ-loop DUF4929 AGRB_N
Other DBs
NCBI-GeneID: 287478
NCBI-ProteinID: NP_001178576
RGD: 1308466
Ensembl: ENSRNOG00000028688
UniProt: D3ZG79
Position
10q24
AA seq 367 aa
MMKNWLLILTLFLLKFIERSESTVGLSAPPTVKLVNGSSTNVSITLGHPLNSTLVITFEI
TFSSKNLTIVELPDEVIVPRGEKNASFQVTSQNIGQVTVYLHGNHSNQTCPRIQFLVIHS
RIVSVINQVIGWIYFMAWSVSFYPQVIQNWRRKSVVGLSFDFLALNLTGFVAYSVFNIGL
LWVPYIQEEFLLKYPNGVNPVDINDAFFSLHAVALTLIVILQCCLYERGNQRVSRPSIGF
LVLAWLFILVTMIVAAVGVTTWLQFLFCFSYIKLIITLIKYFPQAYMNFYYKSTKGWSIG
GVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFTIFFDIVFFIQHFYLYRKK
PGYDQLD
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgatgaagaactggctgcttattttgacccttttccttctgaagttcatagagagaagt
gaatcaaccgtcggtctctctgctcctcccactgtgaagctggtaaatggcagttcaacc
aacgtcagcattacccttgggcatccactaaattcgaccttggtgatcacttttgaaatc
acatttagttcaaaaaaccttactattgtggagcttcctgatgaggttatagtgcctcgt
ggagagaaaaatgcctctttccaagtgacttctcaaaatattggacaagtgactgtttat
ctgcatggaaatcattccaaccagacctgccccagaatccagttcttggtgatacacagc
agaattgttagcgtcataaaccaggtgattggctggatctacttcatggcctggtccgtc
tccttctacccacaggtgatccagaactggagacggaaaagtgtcgttggtctcagcttt
gacttcttagccctgaacttgacaggcttcgtggcctacagcgttttcaacatcggtctt
ttgtgggtgccctacatccaggaggagtttctcctcaaataccccaatggtgtgaaccct
gtcgacattaacgacgccttcttcagcttacatgcagtcgccctcaccctgattgtcatc
ctgcagtgctgcctgtatgagcgaggcaaccagcgcgtgtcacggccctccattggcttc
ctggtacttgcgtggctcttcatcttagtcaccatgattgtggctgcagtcggtgtcacc
acatggctgcagttcctcttctgcttctcctacatcaagctcatcatcacactgatcaag
tatttcccccaggcctacatgaacttttactacaaaagcaccaagggttggagcattggt
ggtgtgctcctggattttacagggggcagctttagcctcctccagatgttcctccagtct
tacaataatgaccaatggacattgatcttcggagatccaaccaagttcggacttggcgtc
ttcaccatcttctttgacattgtcttcttcatccagcacttctacttgtacagaaagaaa
ccagggtacgaccaactggactaa

DBGET integrated database retrieval system