KEGG   Rattus norvegicus (rat): 287501
Entry
287501            CDS       T01003                                 

Gene name
Olr1498
Definition
(RefSeq) olfactory receptor 1498
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    287501 (Olr1498)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    287501 (Olr1498)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    287501 (Olr1498)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx SieB
Other DBs
NCBI-GeneID: 287501
NCBI-ProteinID: NP_001000030
RGD: 1334181
Ensembl: ENSRNOG00000055339
UniProt: A0A0G2K2Y6
Position
10q24
AA seq 312 aa
MTGNNQTLILEFLLLGLPIPSEYHLLFYALFLAMYLTTILGNLLIILLVQLASHLHTPMY
LFLSNLSFSDLCFSSVTIPRLLQNMQSQVPSISYADCLTQLYFFLVFGDMESFLLVVMAY
DRYVAICFPLHYTSIMSTKFCASLVLLLWMLTISHALLHTLLTARLSFCEKNVILHFFCD
LPALLKLSCSDTYVNELMIFILGGIISIIPFLLIVISYVRIFFSILKASSTQAIHKVFST
CGSHLTVVSLFYGTIIVLYLCPSTNNSTMKETAMALMYTLVTPMLNPFIYSLRNRDMKMA
LIRVICSKKIFL
NT seq 939 nt   +upstreamnt  +downstreamnt
atgactggaaacaaccaaactttgatcttggagttcctcctcctgggtctgcccatccca
tcagagtatcatcttctgttctatgccctgttcttggccatgtacctaacaaccatcctg
ggaaacctgctaatcattctcctggttcaactggcttcccatctccacacacccatgtac
ttgtttcttagcaatttgtccttctctgatctctgcttttcctccgtcacaatacccaga
ttgcttcagaacatgcagagccaagtgccatctatatcctatgcagattgcctgacacag
ctgtacttctttctggtttttggagacatggagagcttccttcttgtggtcatggcctat
gaccgttatgtggcgatctgctttcctttgcattacaccagcatcatgagcaccaagttc
tgtgcttcactagtactactactgtggatgctgacgatatcccatgccctgctgcatacc
ctactaacagctagattgtctttttgtgagaagaatgtgattctccactttttctgtgac
ttaccagctcttctgaaattgtcctgctcagacacttatgttaatgagttgatgatattt
atcctgggagggatcatctctattattccattcctactcattgttatatcctatgtaagg
attttcttctctattcttaaggcctcatctacccaggccatccacaaggtcttttccacc
tgtggatcccatctgactgtggtgtctctgttctatgggacaattattgttttatactta
tgtccatcgactaataattctactatgaaggaaactgccatggctttgatgtatacattg
gtgactcccatgctgaaccccttcatctatagcttgaggaacagagacatgaagatggcc
ctaataagagttatctgcagtaagaaaatatttctgtag

DBGET integrated database retrieval system