KEGG   Rattus norvegicus (rat): 287525
Entry
287525            CDS       T01003                                 

Gene name
Smyd4
Definition
(RefSeq) SET and MYND domain containing 4
  KO
K24634   
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SET zf-MYND TPR_12 DUF3856 TPR_19 TPR_20 TPR_7 Sec16_C
Other DBs
NCBI-GeneID: 287525
NCBI-ProteinID: NP_001099280
RGD: 1307369
Ensembl: ENSRNOG00000026783
UniProt: D4AEC7
Position
10q24
AA seq 801 aa
MDLPVDEWKSYLLEKWALLPKSVQVTISTAETLSDIFLHSSSLLQPEDEMFLKQLSSSCS
VEKDSGAPLFYREEGNKRFQEKEYMGAAVLYSKGVSHSRPNTEDISLCYANRSAALFHLG
QHEACLKDIVRAGMHGYPERLQPKLMIRKTECLVNLGRLQEARQTISDLENSLTTKPTLM
PSSHQILQRNVQQLKMKIQEKETLPESFPAALTKALEDMALGEENKQISGASLSVSLCTD
PLKGRHLVATKDILPGELLVKEDAFVSVLNPGEMPPLRHCLENKWDTRVTSADLYCHRCL
RHTLATVPCGGCSYAKYCSQECVQQAWDHYHSTECSLGGLLLTLGVFCHVALRMTLLARF
EDVDRVIRMICDKTGRKDTCLPESKDLVKTFGYTNQGESEENSETCEPSIPGCNVNGKYE
NNYDAVLSLLPHTEKHSPEHKFICAVSVSALCRQLKATSLQAQTTGLKSPRLKAVTPGLC
TDLTVWGVAMLQHMLQLQCNAQAITSICYAGSKESIITNSRQVRLATGVFPVVSLLNHSC
SPNTSVSFTSTVATIRAAQQIAKGQEILHCYGPHESRMGVAERQQRLSSQYFFDCSCPAC
HAETLRAAVAPRWEAFCCNTCRVPMQGNDVLSCSNESCTNSVSRDRLVSRLQDLQQQVHT
AQKLLRSDRPEQAIQQLLECQRAAENFLSAEHTVLGEIEDGLAQAYATLGDWRQSAAHVQ
KSLQVVEARHGPSSVEIGHELFKLAQVLFNGLAVPEALDAIWKAEKILLVHCGPESDEVQ
ELREMRSCLLDSSFTPVRPLV
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggatctgccagtggatgagtggaaatcctacctacttgagaagtgggctttacttccg
aagtctgtgcaggtcacaatttctacagcagagactctgagcgacatctttcttcactcc
tcttcccttcttcaacctgaggacgagatgttcttgaagcaactttctagtagttgctcc
gtggaaaaggactctggtgctccccttttctacagagaagaaggaaacaaaaggttccaa
gagaaggagtatatgggtgctgcagtgctgtactctaagggagtgtcacattccaggcct
aacactgaggacatttcattgtgctatgccaatcgctctgccgccctcttccatctgggt
cagcatgaagcatgtcttaaagacatagtgagagcaggtatgcatgggtatcctgaaaga
ctgcagcccaagttgatgattcgtaagacagaatgcctggtgaacctggggagactccag
gaggcaagacagaccatcagtgatctggaaaacagcctcactaccaagccaaccctgatg
ccttcctctcatcagattctgcagaggaatgtccagcagctaaaaatgaagatccaagaa
aaggagactctcccagaatctttccctgcagctctcaccaaagccttggaggatatggcc
ctgggggaagagaacaaacagatttctggggcgtccctctctgtcagcttatgcacagac
cctctgaaaggccgccatctagttgccacaaaagacattctcccaggagaactcctggtg
aaggaagatgcttttgtaagtgtccttaacccaggagaaatgccaccactgcgtcattgc
ctagagaacaagtgggatactagagttaccagtgcagacctctactgtcaccgatgtctg
aggcatactttggccacagtaccctgtggtggctgtagctatgccaagtattgtagccag
gaatgcgtgcagcaggcgtgggaccactaccatagcacagagtgctctctgggggggcta
ctcctcacactcggggtcttctgccacgttgccctgaggatgactcttttagccagattt
gaagatgtggacagagttataaggatgatttgtgacaagactggtcgcaaagatacctgt
ttacccgaaagcaaggatctggtcaaaacatttggttacacaaatcagggggagagtgaa
gagaacagcgaaacatgtgaaccctccattcctggatgtaatgtcaatgggaagtatgaa
aataattatgatgctgtcctcagccttctgccccatactgaaaaacacagcccagaacac
aaattcatctgtgcagtcagtgtctccgcactgtgcagacagctcaaagctaccagcttg
caggcccaaaccacgggcttaaagtcccccaggctgaaagcagtgactccagggctgtgt
acagatttgactgtttggggagtagccatgctgcaacacatgctacagctgcagtgtaat
gcccaggcgatcacctccatatgctacgccgggtctaaagagagcatcattaccaacagc
aggcaggtacgccttgccacaggcgtctttcctgttgtcagcctcctgaaccactcctgc
agtcccaacaccagtgtgtccttcactagcactgtcgccaccatccgggcagcacagcag
atcgcaaaaggacaagagattctgcactgctacgggcctcatgagagccggatgggtgtt
gctgagaggcagcagaggctgagttctcagtacttctttgactgcagctgtccagcctgt
cacgctgagacactgagagcagctgtggcacccaggtgggaagccttctgttgtaacact
tgcagagtgcccatgcagggaaatgatgtgctgagctgtagcaacgaatcttgcacaaac
tctgtcagcagggaccgactggtctcccgcctgcaggaccttcagcaacaggttcacaca
gcccagaagcttctcaggagtgatagaccagagcaagccattcagcagttgttggagtgc
cagagggctgctgagaacttcttgtcagcagagcacaccgtgctgggagaaattgaagac
ggcctggcccaggcctatgctaccttaggcgactggcgacagtctgctgcccatgtacag
aagagtctccaggtggttgaggctcgccatgggccatccagtgttgaaattggccatgag
ctcttcaaactggcccaagtcttgttcaatgggttggcagtgcctgaagctctggatgcc
atatggaaggcagaaaagatcctgttggtgcactgtggccctgagagtgatgaggtccag
gagctccgggagatgaggtcctgcttactggactcgtccttcacccctgtgcggccctta
gtgtag

DBGET integrated database retrieval system