KEGG   Rattus norvegicus (rat): 287527
Entry
287527            CDS       T01003                                 

Gene name
Serpinf2
Definition
(RefSeq) alpha-2-antiplasmin precursor
  KO
K03983  alpha-2-antiplasmin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    287527 (Serpinf2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    287527 (Serpinf2)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   287527 (Serpinf2)
SSDB
Motif
Pfam: Serpin DUF2127
Other DBs
NCBI-GeneID: 287527
NCBI-ProteinID: NP_001011892
RGD: 1306692
Ensembl: ENSRNOG00000003233
UniProt: Q68FT8
Position
10
AA seq 491 aa
MALLRGLLVLSLSCLQGPSSMFSPVSAMDLPGQQPVSEQAQQKLPPLALLKLGNQDLGDH
ATLKRSPGDCKSAPTTEETRRLSQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHL
ALGARNQTLENLQRVLHMNMGSCIPHLLSHFCQNLNPGTIRLAARIYLQKGFPIKDDFLE
QSEKLFGAKPVKLTGRQEEDLMNINKWVKEATEGKIEDFLSELPDNTVLLLLNAIHFHGF
WRTKFDPSLTQKDSFHLDEQFTVPVAMMHAQSYPLRWFLLEQPEIQVAHFPFQNNMSFVV
IMPTYFGWNVSEVLANLTWDTLYQPSMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLF
QSPDLRGISDQSLVVSSVQHQSTMELSEAGVEAAAATSTAMTRMSLSSFFLNRPFIFFIM
EETIGIPLFVGSVRNPDPSAQPQPQEQQDSPDNRRLDQNDKADIPGGKTFAPDLKLVPRL
EEDYPQFSSPK
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggcactgctccgggggctcctggtacttagcttgtcctgtctgcaaggtcccagttca
atgttctctcctgtgagtgccatggatctcccgggccagcagccagtgagtgagcaagcc
cagcagaagctgcccccacttgccctcctcaagttgggcaaccaggatcttggtgaccat
gctaccctgaagaggtccccaggagattgcaagagtgccccaactacagaggagactcgc
aggctgtctcaggccatgatggcttttactactgacctgttctccctggtggcccaaaca
tccaccagctccaaccttgtcctgtcaccccttagtgtggccctagcactctctcacctg
gcactaggtgctcggaaccaaacactggagaacctgcaacgagtgctgcacatgaacatg
ggatcctgcatcccgcatctactgagccatttctgccagaacctaaaccccgggacaatc
cgactggcggccagaatatacttgcagaaaggatttcccatcaaagatgatttcctggag
caatcggaaaagctctttggcgcgaagcccgtgaaactgactggaaggcaggaagaagac
ctgatgaacatcaacaaatgggtgaaggaggccacagaagggaagattgaggatttcctc
tctgagctgccggataacaccgtgctgctcctcctcaatgccatccactttcacggtttc
tggaggaccaagtttgaccccagcctcacccagaaagactccttccacctggacgagcag
ttcacggtgccagtggccatgatgcacgcacagtcatacccccttcgatggttcctgctg
gagcaacctgagatacaggtggctcatttcccatttcagaacaacatgagcttcgtggtc
ataatgcccacttactttgggtggaacgtgtccgaggtactagccaacctgacctgggac
actctgtaccagccctcgatgcgggagaagcccaccaaggtgcggctgcctaaacttcat
ctggaacagcatctggacctggtggccaccctcagcaagctgggcctacaggacttgttc
cagagcccagacctgcgtgggatctctgaccagagtctggtggtgtctagtgtgcagcac
cagtctaccatggagctcagtgaggctggtgtggaggcagcggcagctaccagcacagcc
atgactcgaatgtccctttcctccttctttttgaaccgaccattcatcttcttcatcatg
gaggagaccataggcatacccctctttgtgggaagtgtgagaaaccctgaccccagtgca
cagccccagccccaggaacagcaagactcccctgacaacaggcgcttagaccagaatgac
aaagctgacatccccggaggcaagacctttgctcctgacttgaaacttgtgccccgcctg
gaggaagattatccccagtttagctcccccaaatga

DBGET integrated database retrieval system