KEGG   Rattus norvegicus (rat): 287530
Entry
287530            CDS       T01003                                 

Gene name
Prpf8
Definition
(RefSeq) pre-mRNA processing factor 8
  KO
K12856  pre-mRNA-processing factor 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    287530 (Prpf8)
Spliceosome [BR:rno03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    287530 (Prpf8)
 Complex C
   U5 SnRNP specific factors
    287530 (Prpf8)
SSDB
Motif
Pfam: PROCN PRP8_domainIV U6-snRNA_bdg PRO8NT U5_2-snRNA_bdg PROCT RRM_4 JAB
Other DBs
NCBI-GeneID: 287530
NCBI-ProteinID: NP_001178519
RGD: 1305467
Ensembl: ENSRNOG00000003495
UniProt: G3V6H2
Position
10q24
AA seq 2335 aa
MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKED
MPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLY
HITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYAD
NILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDIN
KIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPIS
HRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRR
ALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRF
GNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMR
QIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQF
EGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLT
RLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLI
LALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMD
LYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYK
DMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATE
AAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARM
RLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIV
NKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPK
ELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFI
DSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEG
LFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGI
FMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSY
KMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPAL
YVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTT
KPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQ
IIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTVTEPHHIWPTLTDEEWIKVE
VQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLT
ATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKET
GYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
SQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTP
GSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWN
YNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA
NT seq 7008 nt   +upstreamnt  +downstreamnt
atggccggagtgtttccttacagagggccgggtaacccggtgcccggccctctagccccg
ctgccggattacatgtcagaggagaagctgcaggagaaagctcgaaaatggcagcagttg
caggccaagcgctatgcagagaagcggaaattcgggtttgtggatgctcagaaggaagac
atgcccccagaacatgtcaggaaaatcattcgagaccatggagacatgaccaacaggaag
ttccgtcatgacaaaagggtctatttgggagctctcaagtacatgcctcacgcagttctc
aagctcctagagaacatgcccatgccttgggagcagatccgggatgtgcctgtgctgtac
cacatcactggagccatttccttcgttaacgagattccctgggttattgagccagtttac
atctcccagtgggggtcaatgtggatcatgatgcgtagagaaaaaagagacaggaggcat
ttcaagaggatgcgttttcccccttttgatgatgaggagccgcccctggattatgctgac
aacatcttagatgtcgagccactggaagccattcagctagagctggaccctgaggaggat
gcccctgtgttggactggttctatgaccaccagccattgagagatagtaggaagtatgtt
aatggttccacctaccaacgctggcagttcacattgcctatgatgtccactctctaccga
ctggccaaccagcttctgactgacttggtagatgacaactacttttatctctttgatcta
aaggccttctttacctctaaggcactcaacatggccattcctgggggacccaaatttgaa
cctcttgttcgagacatcaacctacaggatgaagactggaatgaattcaatgatattaac
aagatcatcatccgtcagcctattcgtactgagtacaagattgcttttccgtacctctat
aacaacctcccacaccatgtccacctgacctggtaccacactcctaacgttgtgttcatc
aagactgaggatcctgatctgccagctttctactttgatcctctgattaacccaatctcc
catagacactcagtcaagagccaagagccactacctgatgatgatgaggagtttgagctc
ccagagtttgtggagcccttcctgaaggatacacctctctatacagacaatacagccaat
ggcatcgcactgctctgggcaccacggcccttcaacctacgctctggtcgtacccgccgg
gccctcgacattccccttgtcaagaactggtatcgggagcactgtcctgctgggcaacct
gtgaaagttcgagtctcctatcagaagctgcttaagtattatgtgctgaatgccctcaaa
catcggcctcccaaagcgcagaagaagaggtatctgtttcgctctttcaaagctaccaaa
ttctttcagtctaccaagctggactgggtggaggtcgggctgcaggtttgccgccagggc
tacaacatgcttaaccttctcattcaccgtaagaacctcaactatctgcatttggactat
aacttcaacctgaagcctgtcaagacgctcaccaccaaggaaagaaaaaaatctcgcttt
gggaatgctttccatctgtgtcgggaagtactgcgtttgactaagctggttgtggatagt
catgtgcagtatcgcttgggcaatgtagatgccttccagctggcagatggattgcagtat
atatttgcccacgtgggacagttgacaggcatgtatcgatacaaatataagctgatgcgg
cagatccgcatgtgcaaggacttgaaacatctcatctattaccgcttcaacacgggtcct
gtggggaaaggccctggctgtggtttctgggctgctggctggcgggtctggctatttttt
atgcgtggaattacccctttgctagaacgatggctaggcaaccttctggcccgacagttt
gaaggccgtcactcaaagggggtggcaaagacagtaacaaagcaacgagtagagtcccat
tttgaccttgagcttagggcagctgtgatgcatgatattctggacatgatgcctgaaggc
atcaaacagaacaaggcccgaacaattctgcagcacctcagtgaggcctggcgctgctgg
aaggccaacattccatggaaggtcccaggactgccaacgcctatagagaatatgattctt
cggtacgttaaggccaaggctgattggtggaccaatactgcccactacaaccgtgaacgg
attcgccgtggggctactgtagacaagactgtttgcaaaaagaacctgggccgcctcacc
cgcctgtatctgaaggcagaacaggagcggcagcacaattacctgaaggacgggccttac
atcacagcagaggaagcagtggcagtgtatactaccactgtgcactggctggaaagccgt
aggttctctcctatcccgttccccccactctcctacaagcatgacaccaagttgcttatc
ttggctctggagcgactcaaggaagcttatagtgtgaagtctaggttaaaccagtctcag
agggaggagctgggtctgattgaacaagcctatgacaacccccatgaggctttgtcccgc
atcaagcgtcacctcctcacgcagagagcctttaaggaagtgggcattgagtttatggat
ctctatagccaccttgtgccagtgtatgatgtggaaccactggagaaaataactgatgct
tacctggaccagtacctgtggtatgaagcagataaacgccgtcttttcccgccctggatc
aagcctgctgacacagaaccccctccactgcttgtttacaagtggtgccaaggcatcaat
aacctgcaggatgtgtgggagacgagtgagggtgagtgcaatgtcatgctggagtctcgg
tttgagaagatgtatgagaagattgacctgaccctgctcaacaggctgctgcgactcatt
gtggaccacaacatagctgactacatgacagccaagaacaatgtagtcatcaactataag
gacatgaaccatacaaattcatatggaatcatcagaggcctgcagtttgcctcattcatt
gtacagtactatggtttggtgatggatttgcttgtattgggattgcaccgggccagtgag
atggctgggcctccgcagatgccaaatgactttctcagttttcaggacatagccaccgag
gctgcacacccaatccgactcttctgtagatacattgatcgcatccatattttcttcagg
ttcacagcagatgaggctcgggatctgatccagcgttacctgacagaacatccagacccc
aataatgaaaacattgttggctacaataataagaaatgctggccccgagatgcccgtatg
cgtctcatgaagcatgatgtcaacttgggtcgggcagtgttctgggacatcaaaaaccgg
ctgccacgatcggtgactacagtacagtgggagaatagctttgtgtctgtgtacagtaaa
gacaaccccaacctgctgttcaacatgtgtggctttgagtgccgcatcctacctaagtgc
cgtaccagctatgaagagttcacccacaaggacggggtctggaatctacagaatgaggtt
actaaggagcggacggctcagtgtttcctgcgtgtggacgatgagtcaatgcagcgcttc
cataaccgcgtgcggcagattctgatggcctctggctctaccactttcaccaagattgtg
aataagtggaatacagctctcattggccttatgacatactttcgagaggctgtggtgaat
acacaggaactcctagacttactggtgaagtgtgaaaacaagatccagacacgtatcaag
attggattgaactccaagatgccaagtcggttcccccctgttgtattctacacccctaag
gagctgggtgggcttggcatgctctcgatgggccatgtccttatcccccagtctgacctc
aggtggtccaagcaaacagatgtgggcatcacacactttcgttcaggaatgagtcatgaa
gaagaccaactgattcccaacttgtaccgctacatacagccatgggagagtgaattcatt
gactcccagcgggtctgggctgagtatgcactcaagcgacaggaggctattgctcagaac
agacgcttgactttagaagatttagaagactcgtgggatcggggcattccccggatcaat
accctcttccagaaagatcggcacacattggcttatgataaaggctggcgtgtccgaact
gactttaagcagtaccaggttttgaagcagaaccccttttggtggacacatcaacggcat
gatggcaagctttggaacctcaacaactaccgcacagacatgatccaggcactgggcggt
gtggagggcattctggaacacactctcttcaagggcacttacttcccaacctgggaaggt
ctgttctgggagaaagccagcgggtttgaggaatccatgaagtggaagaagctgaccaat
gctcagcgatcaggattaaaccagattcctaatcgtagatttactctctggtggtcccca
acaatcaatcgagccaatgtatacgtaggcttccaggtgcagctggacctgacaggaatc
tttatgcatggcaagatccccacgctgaagatctctctcatccagatcttccgagctcac
ttgtggcaaaagattcatgagagcatcgtgatggacttgtgtcaggtcttcgaccaggaa
ttagatgccctggaaattgagacagtacaaaaggagacaatccatccccgaaaatcctac
aagatgaactcttcctgtgcagatatactgctctttgcttcctataagtggaatgtctcc
cggccctcgctgctggcagactctaaggatgtgatggacagcaccaccacacagaagtat
tggattgacatccagttacgctggggggactatgattcccatgatattgagcgctatgcc
cgggccaagttcctggattacaccacagacaacatgagtatctacccttcacccacaggt
gtgctcattgccattgatctggcctataatctacacagtgcctatggaaactggttcccg
gggagcaagcctctcatacagcaagccatggccaagatcatgaaggcaaaccctgccttg
tatgtgttacgtgaacggatacgcaaaggattgcagctgtattcatctgagcccactgag
ccttacctgtcctctcagaactatggtgaactcttctcgaaccagattatctggtttgtg
gatgacaccaatgtctatagagtaactatccacaagacctttgaggggaacttgacaacc
aaacccatcaatggggccatcttcatcttcaatccacgcacaggacagctgttcctcaag
ataatccacacatccgtatgggctggacagaagcgtttgggtcagttggccaagtggaag
actgctgaagaagtggctgccctgatccgatctctgcctgtggaggaacagcctaaacag
attattgtcactcggaaagggatgctggatcccctggaggtacacttactggacttcccc
aatattgtgatcaaaggatcagagctccagctgcccttccaggcttgtctcaaggtggag
aagtttggggatctcatccttaaagccacagaaccacagatggttctcttcaacctctat
gatgactggctcaagactatctcatcctacacggctttctcccgtctcatcctgatcctg
cgtgctttgcatgtgaacaacgatagggcaaaagtgatcctgaagccagacaagacaacc
gttacggaaccccaccacatctggcccacgctcactgacgaggagtggatcaaggtggag
gtgcagctcaaggatctgatcttggctgactatggcaagaaaaacaatgtgaatgtggca
tcgctgacacaatcagaaattcgagacatcatcctgggaatggagatctctgcaccatcg
cagcagcggcagcagatagctgagattgagaagcagaccaaggaacagtcccagctcact
gctacacagactcgaactgtcaacaagcatggcgatgagatcatcacctccaccactagc
aactatgagacccagaccttctcgtcgaagaccgaatggagagtcagggccatctctgct
gccaacctgcatctacggaccaatcacatttatgtttcatctgatgacatcaaggagact
ggttatacgtacattcttcccaaaaatgtgctgaagaagttcatctgcatatctgatctg
cgcgcccaaattgcaggatacctatatggggtgagccctccagataaccctcaggtgaag
gagatccgctgtattgtgatggtgccacagtggggcactcaccagactgtgcacctgcct
agtcagctgcctcaacatgagtacctcaaggagatggaacccttaggttggatccacact
caacccaatgaatccccccagctatcgccccaagatgtaactactcatgccaaaatcatg
gctgacaacccatcttgggatggggagaagactattatcatcacctgcagcttcacacca
ggttcctgcacactgacagcctacaagctgacccctagcgggtatgagtggggtcggcag
aacacagacaaaggcaacaaccccaaaggctacctaccttcgcactatgagagggttcag
atgctcctgtctgaccgattcctcggcttctttatggtccctgcccagtcctcctggaac
tacaactttatgggtgttcgacatgaccccaacatgaaatacgagctgcagctagcaaac
cccaaggagttctaccatgaggtccacaggccctcccacttcctcaactttgccctcctg
caggagggtgaggtctattccgcagacagagaggacctctatgcctag

DBGET integrated database retrieval system