KEGG   Rattus norvegicus (rat): 287531
Entry
287531            CDS       T01003                                 

Gene name
Rilp
Definition
(RefSeq) rab-interacting lysosomal protein
  KO
K13883  Rab-interacting lysosomal protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    287531 (Rilp)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    287531 (Rilp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287531 (Rilp)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    287531 (Rilp)
SSDB
Motif
Pfam: RILP Jnk-SapK_ap_N Macoilin
Other DBs
NCBI-GeneID: 287531
NCBI-ProteinID: NP_001099281
RGD: 1307691
Ensembl: ENSRNOG00000003784
UniProt: D3ZGA5
Position
10
AA seq 366 aa
MEPRRAAPGLLSQASLVGTGSVAELVYHLAGALGTELQELARRFGPDAAAGLVPLVVRAL
ELLEKAAVGPAPDWVSTQQAEVELRRLREENQRLRQELGSEPQEERALLRQLKEVTDRQR
DELRAHNRDLLRRSQETEALQEQLQRLLLVNSELRHKLAAVQTQLRAARDRERERQTARD
RSQQLAKEQSLEPDAATPDDPVDAQKQSGNPPEAVQCGFSREEVEQILQERNELKANVFL
LKEELAYFQREMLTDHRVPGLLLEAMKVAVKKQRRKIKAKMLGTPEEAESSDDEDGSWLL
LSNDKEDVPLVPGSRIQNFFGLWYQGETEAPEAETSNTAPSRTQEGEGAPPQPYLQPVDN
LPAPSS
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggagcccaggagggcagcgcctgggctactcagccaggcctctttagtgggcacgggg
tcagtcgctgagctggtataccatctagcgggggctctgggcactgagctacaggaactg
gcacgccgtttcggacccgatgcggcagctgggctggtgccactagtagtgcgggcgctg
gagctcttggaaaaggccgccgtggggccggctccagactgggtgtccacacagcaggct
gaagtggaactgcggcggctgcgtgaggagaaccagcgcctccgccaggagctaggctcc
gagccgcaggaggagcgcgcgctgctccgacagctcaaggaggtgacagacagacagcgg
gatgagcttcgggcacacaaccgagatctgctgcgccgaagccaggagaccgaagcgctg
caggaacagctgcagcgcctcctgctggtcaactctgagctgaggcacaagctggccgca
gtgcagacccaattgagggcggcgcgggaccgggagagagagcgccagacagctcgggat
cgttcccaacagctggccaaagaacagagcttggagcccgatgcggcaaccccagatgac
ccggtggatgctcagaagcagtcagggaaccctccagaggctgtccagtgtggattcagc
agggaagaggttgagcagatccttcaggagcggaatgagctcaaagccaatgtattcttg
ctcaaggaggagttggcatatttccagcgagagatgctcacagaccaccgagtccctggg
cttctgcttgaagccatgaaagtggcagtcaaaaaacagaggagaaagatcaaggccaag
atgttggggacacctgaagaagcagagagcagtgatgatgaggatggctcgtggctcctg
ctctctaatgacaaggaagatgttcccctagttcctgggtccagaatccagaatttcttt
ggcttatggtatcagggggaaactgaggcccctgaagctgagaccagcaacacagctccc
agcaggacacaggaaggagaaggggccccaccgcaaccctacctgcaacctgtggacaac
cttcccgcccccagctcctga

DBGET integrated database retrieval system