KEGG   Rattus norvegicus (rat): 287533Help
Entry
287533            CDS       T01003                                 

Gene name
Inpp5k, Skip
Definition
(RefSeq) inositol polyphosphate-5-phosphatase K
  KO
K01106  inositol-1,4,5-trisphosphate 5-phosphatase [EC:3.1.3.56]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Module
rno_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    287533 (Inpp5k)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    287533 (Inpp5k)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     287533 (Inpp5k)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SKICH Exo_endo_phos HECW_N
Motif
Other DBs
NCBI-GeneID: 287533
NCBI-ProteinID: NP_001013881
RGD: 1359130
Ensembl: ENSRNOG00000056954
UniProt: Q5XIU8
Position
10q24
AA seq 446 aa AA seqDB search
MTTASLRKPSAPKELMLSIHVVTWNVASAAPTVDLSDLLQLNNEDLNLDIYIIGLQEMNY
GIISLLSDAAFEDPWSSFFMDMLSPLNLVKISQVRMQGLLLLVFAKYQHLPYIQIISTKS
IPTGLYGYWGNKGGINICLKLYGYYVSIVNCHLPPHMYNNDQRLEHFDRILESLTFEGYD
VPNILDHDLILWFGDMNFRIEDFGLLFVQECITKKRYKELWEKDQLFIAKKQDQLLREFQ
EGPLLFPPTYKFDRHSNNYDTSEKKRKPAWTDRILWRLKRQPAKANPSGFLLTQKDYVSH
MTYSISDHKPVTGTFDLELNPLMSVPLITMMPEYLWTKENDMLINYTSTPEFLSSPWDWI
GLYKVGMRHINDYVSYVWVGDNQVSRGNNPNQVYINISAIPDTEEQFLLCYYSNNLHSIV
GISQPFKIPSGFFLREDTLSELEPQL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgcgagtctaaggaagccgagcgcaccaaaagagcttatgctcagcatacac
gttgtaacatggaatgtggcctctgcagcccccactgtggacctcagtgacctacttcaa
ctgaacaacgaagacctgaatctggacatatatatcattggtttgcaggaaatgaattat
gggatcataagccttctttctgatgctgcctttgaggacccatggagcagtttcttcatg
gatatgctttctccactgaaccttgtcaagatctctcaagtccgtatgcaggggcttctc
ttactggtctttgccaagtatcagcatttgccctacatccagatcatctctacaaaatcc
attcctactggcctctacgggtactgggggaacaaagggggaatcaacatctgtctgaag
ctttacggctactatgtcagcatcgtcaactgccacctgcctccccacatgtacaacaat
gaccagcgcctggagcactttgaccgcatcttggagagtctgacttttgagggatatgat
gtccccaacatcctggaccatgacctcattctgtggtttggagacatgaactttcgaatc
gaggactttgggctgctctttgttcaggagtgtataacaaagaagcgctacaaagagctg
tgggagaaagatcagctcttcattgccaagaaacaggaccagctgctccgggagttccag
gaaggcccactgctcttcccacccacctacaagtttgacaggcactccaacaactatgac
accagtgagaaaaaacgcaagcctgcgtggactgaccgaatcctgtggaggttgaagcgg
cagccagccaaggccaacccctccggcttcttgttgacacagaaggactatgtcagccac
atgacatacagcatcagtgaccataagcctgtcactggcaccttcgacttggagctgaac
ccactgatgtctgtcccactgatcactatgatgcctgaatacctgtggaccaaggagaac
gacatgctgatcaactacacctccaccccagagttcctcagcagcccctgggactggatc
ggactatacaaggtggggatgcgacacattaatgactatgtatcctatgtctgggtcggt
gacaaccaagtctcccgtggtaacaacccaaaccaggtgtatatcaacatcagtgctatc
cctgacacggaggagcagtttcttctctgttactatagcaacaacctgcactctatagtg
gggataagtcaacccttcaagatcccgtccggcttctttttgagagaggacacactgtct
gagcttgaaccacagctctga

DBGET integrated database retrieval system