KEGG   Rattus norvegicus (rat): 287534Help
Entry
287534            CDS       T01003                                 

Gene name
Rflnb, Fam101b, RGD1359691
Definition
(RefSeq) refilin B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM101
Motif
Other DBs
NCBI-GeneID: 287534
NCBI-ProteinID: NP_001007612
RGD: 1359691
Ensembl: ENSRNOG00000006674
UniProt: Q6AXS9
Position
10q24
AA seq 216 aa AA seqDB search
MVGRLSLQDVPELVDTKKKGDGVLDSPDSGLPPSPSPSHWGLAAATGGGGERAPVAGTLE
PDATVTSVVPNPASLSHSLAGICSPRLCPLSFGEGVEFDPLPPKEIKYTSSVKYDSERHF
IDDVQMPLGLVVASCSQTVTCIPNCTWRNYKAEVRFEPRHKPARFLSTTIIYPKYPKTVY
TTTLDYNCHKKLRRFLSSVELEATEFLGSDGLLDEC
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggtgggccgactgagcctgcaggatgtccccgagctcgtggacacgaagaaaaaagga
gacggcgtcctggacagcccggactcggggctgcccccaagccctagccccagccactgg
gggctcgcagcggcgacgggcggcggtggggagcgcgctccggtcgcagggacgctggag
cccgatgcgacggtcacctccgtagtcccgaacccagcatctctgagccactcactggct
ggcatctgctcaccacgactctgtcccctgtccttcggcgaaggagtcgagtttgacccc
ttaccaccaaaggaaataaagtatacctcctcagtcaagtacgactctgagcggcatttc
atcgatgatgtgcagatgcccctgggcctggtggtggcttcctgcagccagacagtcacc
tgtatccccaattgcacttggcgaaactataaggctgaagtgcgcttcgagcctcgccac
aagcctgcgcgcttcctcagcaccaccatcatctaccccaagtacccgaagaccgtctac
accaccactctggattacaactgccacaagaaactgaggaggtttctatccagtgtggag
ctggaggccacggagttcctaggtagcgatgggctgttggatgaatgctga

DBGET integrated database retrieval system