KEGG   Rattus norvegicus (rat): 287545Help
Entry
287545            CDS       T01003                                 

Gene name
Sarm1
Definition
(RefSeq) sterile alpha and TIR motif containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SAM_2 SAM_1 TIR_2 SAM_3 SAM_PNT Carb_kinase Arm
Motif
Other DBs
NCBI-GeneID: 287545
NCBI-ProteinID: NP_001099287
RGD: 1310078
Ensembl: ENSRNOG00000010244
UniProt: D3ZUM2
Position
10q25
AA seq 724 aa AA seqDB search
MVLTLLFSAYKLCRFFIMSGPRPGADRLTVPGPDRSGGTSPWWAAGGRGSREVSPGVGTE
VQGALERSLPELQQALSELKQASAAQAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAI
RLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLSKEREPVEL
ARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALANCALHGGQT
VQRCMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVEHSGTLALVEPLV
ASLDPGRFARCLVDASDTSQGRGPDDLQSLVLLLDSSRLEAQCIGAFYLCAEAAIKSLQG
KTKVFSDIGAIQSLKRLVSYSTNGTTSTLAKRALRLLGEEVPRRILPCVASWKEAEVQTW
LQQIGFSQYCENFRDQQVDGDLLLRLTDEELQTDLGMKSSITRKRFFRELTELKTFASYA
TCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIRLGVHRTRILS
AAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEA
GKFEDKLIQSVMAARNFVLVLSAGALDKCMQDHECKDWVHKEIVTALSCSKNIVPIIDGF
EWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRPSQDSSAGSDTSLEGATS
MGLP
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgacgctgctcttctccgcctacaaactgtgccgcttcttcatcatgtcaggc
ccacggccgggcgccgatcggctgacagtaccgggaccggatcggagtggcggcaccagc
ccatggtgggctgcgggcggtcgcgggtctcgcgaagtgtcgcccggggtgggcaccgag
gtgcaaggcgcgctggagcgttcgctgccggagctgcagcaggcgctgtccgagctgaaa
caggcaagcgcggcgcaagcggtgggcgcgggcctcgccgaggtcttccagctggtagag
gaagcctggctgctgccggccgtgggccgcgaggtggcccaaggtttgtgcgatgctata
cgtctggacggtggcctcgacttgctgttgcggctgcttcaggcaccggagctagagacc
cgcgtgcaggccgcgcgcttgctggagcagatcctggtggctgagaaccgggaccgcgta
gcgcgcatcggcctaggcgtgatcttgaacctgtcgaaggaacgcgagcctgtggagctg
gcacggagcgtggcgggcatcttggagcacatgttcaagcactcggaggagacctgccag
cggctggtggcggccggaggcctcgacgcggtgctgtattggtgccgccgcacagaccca
gcgctactgcgccactgcgcgctggcgctggcaaactgcgcgctgcacgggggccagact
gtgcagcggtgcatggtggagaagcgcgccgccgagtggctcttcccgctcgctttctcc
aaagaggacgagttgctgcggctgcatgcttgcctggcggtggccgtgttggctaccaac
aaggaggtagaacgcgaggtcgagcactcaggcacgttggcgctcgtcgagccgctggtg
gcatcgctggatcctggccgcttcgctcgttgcctggtggatgccagtgacacaagccag
ggtcgtggaccagacgacctgcagagcctggtgctgttgctcgattcgtcgcgtttggag
gctcagtgcataggggctttctacctgtgcgccgaggctgccatcaaaagcctacaggga
aagaccaaggtattcagcgacatcggcgccatccagagcctgaaacgcctggtttcttac
tccacaaatggcaccacgtcgacgctggccaagcgcgcgctgcgcctattgggcgaggag
gtgccaaggcgcatcctaccctgcgtggccagctggaaggaggctgaggtccagacctgg
ctgcagcagatcggcttctcccagtactgcgagaactttcgggatcagcaggtagatggt
gatttgcttctacgactcacagatgaagaactccagacagacctaggcatgaaatcaagc
atcacccgcaagaggttctttagggagctcacggagctcaagaccttcgccagctatgct
acttgcgaccgcagcaacctagcagactggctgggcagcctggatcctcgcttccgccag
tacacctatggcctggtcagctgcggcctggaccgctccctgctgcaccgcgtgtcagag
cagcagctcctggaggactgtggcatccgcctgggggtgcatcgcacgcgcatcctctct
gcagccagagaaatgctacattccccgctgccctgtaccggaggcaagcccagtggagac
accccagatgtctttatcagctaccgcaggaactcgggttcccagctggccagcctcctg
aaggtgcacctgcagctgcatggcttcagtgtcttcatcgatgtggagaagctggaggcc
ggcaaattcgaggacaagctcatccagagtgtcatggcggctcgaaattttgtgctggtg
ctgtctgcgggagcgctggataagtgcatgcaggaccatgaatgcaaggactgggtgcac
aaggagatcgtgactgccttaagctgtagcaagaacattgtgcccatcattgatggcttt
gagtggcctgagcctcaggcactgcctgaggatatgcaggctgtactcaccttcaacggc
atcaaatggtctcatgagtaccaggaggccaccatcgagaaaatcatccgcttcctacag
ggtcgcccctctcaggactcctctgccggctctgacaccagtttggagggagctacatca
atgggtctgccttaa

DBGET integrated database retrieval system