KEGG   Rattus norvegicus (rat): 287552Help
Entry
287552            CDS       T01003                                 

Gene name
Blmh
Definition
(RefSeq) bleomycin hydrolase
  KO
K01372  bleomycin hydrolase [EC:3.4.22.40]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    287552 (Blmh)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.40  bleomycin hydrolase
     287552 (Blmh)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C1: papain family
   287552 (Blmh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1_2 Peptidase_C1
Motif
Other DBs
NCBI-GeneID: 287552
NCBI-ProteinID: NP_001029335
RGD: 1304668
Ensembl: ENSRNOG00000003563
Vega: OTTRNOG00000001202
UniProt: A1A5L1
Position
10q24
AA seq 455 aa AA seqDB search
MNNAGLNSEKVAALIQKLNSDPQFVLAQNVGTTHDLLDICLKRATVQGAQHVFQHVVPQE
GKPVTNQKSSGRCWIFSCLNVMRLPFMKKFNIEEFEFSQSYLFFWDKVERCYFFLNAFVD
TAQKKEPEDGRLVQYLLMNPTNDGGQWDMLVNIVEKYGVVPKKCFPESHTTEATRRMNDI
LNHKMREFCIRLRNLVHSGATKGEISSTQDAMMEEIFRVVCICLGNPPETFTWEYRDKDK
NYHKVGPITPLQFYKEHVKPLFNMEDKICFVNDPRPQHKYNKLYTVDYLSNMVGGRKTLY
NNQPIDFLKKMVAASIRDGEAVWFGCDVGKHFNGKLGLSDMNVYDHELVFGVSLKNMNKA
ERLAFGESLMTHAMTFTAVSEKDDQEGAFVKWRVENSWGEDHGHKGYLCMTDEWFSEYVY
EVVVDKKHVPEEVLAVLEQEPIVLPAWDPMGALAE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgcaggactaaattcggagaaggtagctgctttgatccagaaactaaattct
gaccctcagttcgtacttgcccagaatgtcgggaccacccacgatctgctggacatttgt
ctgaagagggccacagtccagggtgctcagcatgtgttccagcacgttgtgcctcaggaa
ggcaagccagtcaccaaccagaagagctctggacgatgctggatcttttcttgtttgaat
gttatgagacttccattcatgaaaaaatttaacattgaagaatttgagtttagtcagtct
tacctgtttttttgggacaaggtcgaacgctgttacttcttcttgaatgcttttgtggac
acagcccagaaaaaagagcctgaagatggaagactggtgcagtatttgcttatgaaccct
acaaatgatggtggacagtgggatatgcttgtcaatattgttgaaaaatatggtgttgtc
cctaagaaatgcttccctgaatcgcatacgacagaggccaccagaagaatgaacgatatt
ctgaatcacaagatgagagaattctgtatacggcttcggaacctggtacacagtggagca
accaaaggagagatctcatctacacaagatgccatgatggaggagatattcagagtagtg
tgcatatgtttgggtaacccaccagagaccttcacctgggagtatcgagacaaagataaa
aactaccacaaggtcggccccataacacccttgcagttttacaaggaacacgtgaagcca
ctcttcaacatggaagataagatttgttttgtgaatgacccacggccccagcacaagtac
aataaattgtacacagtagactacttgagcaatatggttggagggagaaaaacgctgtat
aacaaccagcccattgacttcttgaaaaagatggttgctgcctccatcagagatggagag
gctgtgtggtttggctgtgatgttgggaagcacttcaatggcaagctgggcctcagtgac
atgaatgtctatgatcacgagttagtgttcggtgtctccttgaagaacatgaacaaagct
gagaggttggcttttggtgagtcactcatgacccacgccatgaccttcactgctgtctca
gagaaggatgaccaggaaggtgcatttgtgaaatggagagtagagaattcatggggtgaa
gaccacggccacaaaggttacctgtgcatgaccgatgagtggttctctgagtatgtctac
gaggtggtggtggacaagaagcatgtcccagaagaggtgctggctgtgttagagcaggag
cctattgtcctgccggcatgggaccccatgggggctttggctgaatga

DBGET integrated database retrieval system