KEGG   Rattus norvegicus (rat): 287561
Entry
287561            CDS       T01003                                 

Gene name
Ccl7
Definition
(RefSeq) C-C motif chemokine 7 precursor
  KO
K05509  C-C motif chemokine 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287561 (Ccl7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    287561 (Ccl7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    287561 (Ccl7)
   04062 Chemokine signaling pathway
    287561 (Ccl7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    287561 (Ccl7)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   287561 (Ccl7)
SSDB
Motif
Pfam: IL8 Laminin_G_3
Other DBs
NCBI-GeneID: 287561
NCBI-ProteinID: NP_001007613
RGD: 1359152
Ensembl: ENSRNOG00000000239
UniProt: Q9QXY8
Position
10
AA seq 97 aa
MQISAALLCVLLTAAAFTVHVWAQPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWE
AVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP
NT seq 294 nt   +upstreamnt  +downstreamnt
atgcagatctctgccgcgcttctgtgtgtgctgctcacagctgctgctttcaccgtgcac
gtgtgggcccaaccagatgggaccaattcatccacttgctgctatgtcaagaaacaaaag
attcccaagaggaatctcaagagttacagaaagatcaccagtagtcggtgtccctgggaa
gctgttatcttcaagaccaaaaagggcatggaagtctgtgctgaagcccatcagaagtgg
gttgaggaggccatagcatacttagacatgaaaacttcaactccaaagccctga

DBGET integrated database retrieval system