KEGG   Rattus norvegicus (rat): 287607Help
Entry
287607            CDS       T01003                                 

Gene name
Mtmr4
Definition
(RefSeq) myotubularin related protein 4
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    287607 (Mtmr4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    287607 (Mtmr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    287607 (Mtmr4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    287607 (Mtmr4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     287607 (Mtmr4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     287607 (Mtmr4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     287607 (Mtmr4)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    287607 (Mtmr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 287607
NCBI-ProteinID: NP_001099297
RGD: 1310306
Ensembl: ENSRNOG00000007496
UniProt: D3ZW40
Position
10q26
AA seq 1191 aa AA seqDB search
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRASGGSLSAGTNDASEACDTDFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPGSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEVRVSLEPWHSNPEGAEAVIES
GVGSPQLTVGDVGLPPPLPSSQKDYLSNKPFKGHKSCSLSYKLLNTSVSWEMKNTSEIKV
LEETEALAPGPPAREEQSRTSDGLGKPPEQCPEKEATSSLSNVSSKCGGACDFPGEPPQD
SFTGTPQQPHLDSMQAVPIRCTPDHGQGSLCNPPSAASQTLQEPNTDLISQDPPGSMAGI
SYQEQPSSVSDLIYKKEDAGKRGSKNGQLVENPRFGKMPLELARKPISQSQISEFSFLGS
NWDSFQGMMTSFPSGETTPRRLLAYGCCSKRPSNKHIRAAAPCFGGQWAQREGMKSPVCS
SHSNGHCTGPGGKNNRMWFSSHPKQVSSTKPSLLSCPSPVPPLYLDDDGLPFPTDVIQHR
LRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSDTEDF
GSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCGNVFC
AGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQHLKKPIATASS
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggagggcccccccagcctggagtacatccaagccaaggatctgttccccccc
aaggaactggtgaaggaggaggaaaatcttcaggtacccttcacagtgctacagggtgag
ggagtggaattcctgggccgggcagctgatgccctcattgcaatctccaactaccggctg
catatcaagttcaaagactctgtcatcaacgtgcccctccgtatgattgacagtgtggaa
agccgtgatatgtttcagttgcacattgcctgcaaggactctaaagtggtgaggtgccac
ttctccactttcaagcagtgccaagagtggctctcaaggctaagccgggccacagcaaga
cctgccaagcccgaggatctctttgcctttgcctaccatgcctggtgcctggggctgact
gaggaggatcagcatacccacctgtgtcagccaggagagcacatccgatgtcgacaggag
gccgagctcgcaaggatgggttttgacctgcagaatgtctggagagtctcgcatatcaac
agcaattacaagctgtgccctagctacccccagaagctgctggttcctgtgtggatcaca
gataaagagctggagaatgtggcttctttccgctcttggaagcgcatccctgttgtggtg
tacagacacctgcgcaacggggctgccattgcccgctgcagccagcctgagatcagctgg
tggggctggcgcaatgctgatgatgaatacctcgtcacgtccattgccaaagcctgcgcc
ttagacccagggaccagggccagtgggggctccctcagtgctgggactaatgatgccagc
gaggcatgtgacacggatttcgattcttctctgactgcatgctctggggtagagagcaca
gcagccccccaaaaactgctgatcctggatgcacggtcctacacagcagcagtggccaac
cgggccaagggtggaggctgtgaatgtgaagaatactatccgaactgtgaggtcgtgttt
atgggaatggccaacatccatgccatccggaacagcttccagtacctccgggctgtgtgt
agccagatgccagatcccagcaactggttgtcggctctggagagtaccaaatggctacag
cacttgtcagtgatgctaaaagcggctgtgttggtagccaatacagtagatcgggaaggc
cggcctgtgctggtgcactgctctgatggctgggatcgtacgccacagattgtagccctg
gccaaaatactactggatccgtattacaggactctggagggcttccaagtgttagtggag
tctgattggctggattttgggcacaagtttggagatcgctgtggccatcaggaaaatgca
gaggaccaaaatgaacagtgtccggtgttcctccagtggcttgattctgtacatcagctg
cttaagcagttcccctgcctgtttgaattcaatgaagcatttctggtaaaactggtgcag
cacacgtactcctgcctctacggcacattcctggccaacaacccctgcgagcgagagaag
cgcaacatctataaacggacatgctcggtgtgggcactcctgcgagctggcaacaagaac
ttccataacttcctctacacacctgggtcagacatggtcctacatcccgtgtgtcacgtc
cgggccctgcacctctggacagctgtttacctgcctgcgtcatcgccgtgcacccttgga
gaggagaatatggatctttacctttccccagtggctcagagccaggaattttctggtcgt
tctctggacaggttacctaaaaccagatccatggatgatcttctttctgcctgtgataca
agcagccccctcactcgtacttccagtgacccgaacctgaataaccactgtcaggaggtc
agagtcagcctggagccctggcacagcaatcctgaaggagcagaggcagtcatagaatct
ggagtcggaagcccacagctgactgtgggagacgtgggccttcctcctcctctgcccagt
agccagaaagactacttgagcaataaacctttcaagggtcacaaaagttgttctcttagt
tataagttgcttaatacttctgtgtcctgggaaatgaagaacacctctgagatcaaagtc
ctggaagaaactgaagcactggccccgggccctccagcccgagaggagcagagtaggact
tctgatggcttagggaagccacctgaacagtgtccagagaaggaagctaccagctcactc
tccaatgtttccagcaagtgtggaggagcctgtgattttcctggggagcctccccaggat
tcctttacaggtactccccaacagccccatctagactccatgcaggctgtgcccatcagg
tgtactccagatcacggtcagggcagcctttgcaacccaccaagtgctgccagccaaact
cttcaagagccaaatactgacctcatcagccaagatccccctgggtctatggcaggtatc
tcctaccaggaacagcctagttctgtgtcggatctgatctataagaaggaagatgctggc
aagagaggaagtaaaaatgggcagttggtggaaaatcctcgctttgggaaaatgccatta
gagttggcccgaaagccaatttctcagagccagatcagtgagttctcatttttagggtca
aactgggacagcttccaagggatgatgacgtcattccccagtggagagaccactcctcgg
cggctgcttgcttatggctgttgtagcaagaggccgagcaataagcatatccgagctgca
gcgccctgctttgggggccagtgggctcagagagaagggatgaagtcgcccgtctgctct
agtcattccaatggacactgtacaggcccaggaggaaagaacaaccggatgtggttttcc
agtcatccaaagcaagtctccagcacaaagccttctcttctgagctgcccttctccagtg
cctcctctctacctggatgatgatggactcccctttcccacggatgtgatccaacatagg
ttacggcagatcgaagcagggtacaagcaagaggtagaacagctacgtcgacaggttcga
gagcttcagatgaggctagacattcgtcactgctgtgcccctccagcagagccccccatg
gactatgaggatgactttacgtgtttaaaggagtcagatggcagtgacactgaagacttt
ggctctgatcacagtgaggactgcctttcagaagcaagctgggaacctgttgataagaag
gagacggaggtgactcgctgggttccagaccatatggcatcacactgctataactgtgac
tgtgaattctggttggccaaacgaaggcatcattgcagaaattgtgggaacgtattttgt
gctggatgctgccaccttaagctgcccattcccgatcagcaactctatgacccagttctc
gtctgtaactcatgttacgagcacattcaagtgtctcgtgccagggagctcatgagccaa
catctgaagaaacccattgctacagcttccagttga

DBGET integrated database retrieval system