KEGG   Rattus norvegicus (rat): 287612
Entry
287612            CDS       T01003                                 

Gene name
Mks1
Definition
(RefSeq) Meckel syndrome, type 1
  KO
K19332  Meckel syndrome type 1 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    287612 (Mks1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   TCTN-B9D complex
    287612 (Mks1)
SSDB
Motif
Pfam: B9-C2 FUSC
Other DBs
NCBI-GeneID: 287612
NCBI-ProteinID: NP_001030089
RGD: 1565186
Ensembl: ENSRNOG00000008635
UniProt: Q499Q5
Position
10q26
AA seq 561 aa
MAEAVWSTDTGEAVYRSRDPVRNLRLRVHLQRITSSNFLHYQPAAQMGKDLIDLATFKPP
QAASGHRPDEEEEEEVIIGWQEKLFSQFEVDLYQNESACQSPLDHQYRQEVLKLENSGGR
KNRRIFTYTDSDRYTDLEEYCQKITTSAGEAPSFLVERMANVRRRRQDRRGVEGSKLKSR
IITWEPSEDFIRNSHAINTPLQTMYIMADLGPYGKLGYKIHEHVLCVLKVDSNGVITVKP
DFTGIKGPYRIETEGEKQEHTSAWKYTIDNVSSLAQPEEEEREQRVFKDLYGRHKEYLSS
LVGTDFEMIAPGALRLFVNGEVVSARGYEHDNLYVHFFVELPATNWSSPSFQQLSGVTQT
CVTRSLGMDKVAYFSFPFTFEAFFLHEDESDESLPEWPVLYCKVLSLDFWQRYRVEGYGA
VVLPVTPGSHTLTASTWRPMELGLVAELRRFFIGGSLELEDPSYVRIPGTFKGERLSRFG
FRTETTGTVTFRLHCLQQSRAFMESNSLRKQMRSVLDRLEGFSQQSSTHNVLEAFRRARR
RMQEARESLPQDLVSPTGTLA
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcggaagccgtctggagcactgacaccggcgaggccgtgtatcgctcccgggacccc
gtgcgcaacctgcgcctccgagttcatctgcaaagaatcacatcaagcaacttccttcat
taccagcctgctgcccagatggggaaggacctcatagacttggccacttttaagcctcct
caagctgctagtggacaccgccctgatgaagaagaggaggaagaagttataattgggtgg
caggagaagctgtttagccagtttgaagttgacctgtaccaaaatgaatccgcgtgtcag
agcccattagatcatcagtaccgccaagaggtcctgaagctggagaattctggtggcagg
aaaaaccggcgaatcttcacttacaccgactcggatagatacaccgacttagaagagtac
tgtcagaagataaccacttcagccggcgaggcaccatcgtttctggttgagcggatggcg
aatgtcaggcggcggcgccaggacaggcgaggggtggagggcagcaaactcaagtctcga
atcatcacatgggagccctcagaagacttcatcaggaacagccatgctattaacacccct
cttcagacaatgtatatcatggcagacctggggccgtatgggaagcttggctataagata
catgaacatgtcctctgcgtcctgaaggtggatagcaatggagtgatcacagtgaagccc
gacttcactggcatcaaaggaccctacagaatcgagactgagggagagaagcaggaacac
acatctgcttggaaatacacaattgacaacgtgtcctccctcgcacaaccagaggaggaa
gagcgggagcagcgtgtgttcaaggacctttatggccgccacaaggagtacctcagcagc
ctcgtgggcacagactttgagatgattgccccgggtgccctccggctctttgtgaatgga
gaggtagtctcagcccgaggctatgagcatgacaacctctatgtccacttctttgtggag
ctgccagctacgaactggtccagcccatcattccagcagctctcgggagtaacccagacc
tgtgtcaccagatccctgggaatggacaaggtggcctatttctcctttccattcacgttt
gaagccttcttcctccatgaggatgaatcagatgaatcactcccagagtggcccgtgctc
tactgtaaggtcctctcactggacttctggcagaggtatcgtgtggaaggctacggggct
gtggtgctgcctgtcaccccaggatcacacaccttgactgcctccacgtggaggcccatg
gagctgggcctcgtggcagagctaaggaggttcttcattggtggctccctggagctggag
gacccatcctatgtgaggataccaggaaccttcaagggggagcggctgagccgctttgga
ttccgcactgagacgacgggtacggtcaccttccggctgcactgcctgcagcagtcccgg
gctttcatggaatcgaactccctccggaaacaaatgaggagtgtgttggaccgtctggaa
ggattcagccagcagagttccacacacaacgtgctagaagcattccgtcgagcccggcgc
cgcatgcaggaggcccgagagagcctcccccaagaccttgtgagccccacagggacgctg
gcctag

DBGET integrated database retrieval system