KEGG   Rattus norvegicus (rat): 287647
Entry
287647            CDS       T01003                                 

Gene name
Hoxb9
Definition
(RefSeq) homeo box B9
  KO
K09294  homeobox protein HoxB/C/D9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    287647 (Hoxb9)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    287647 (Hoxb9)
SSDB
Motif
Pfam: Hox9_act Homeodomain HTH_23 CI-B14_5a Homeobox_KN
Other DBs
NCBI-GeneID: 287647
NCBI-ProteinID: NP_001093967
RGD: 1306158
Ensembl: ENSRNOG00000007573
UniProt: D3ZW24
Position
10q26
AA seq 250 aa
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFG
ASWAPLSPHASGSLPSVYHPYLQPQGAPAAESRYLRTWLEPAPRAEAAPGQGQAAVKAEP
LLGAPGELLKQGTPEYSLETSAGREAVLSNQRAGYGDNKICEGSEDKERPDQTNPSANWL
HARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKM
KKMNKEQGKE
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtccatttctgggacgcttagcagctattatgtcgactcgatcataagtcacgagagc
gaggacgcgcctccagccaagtttccttcgggccagtacgcgaacccgcggcagccgggc
cacgccgagcacctggacttcccctcgtgcagcttccagcccaaagctccggtgttcggc
gcctcctgggcgccgctgagcccgcacgcttcggggagcctgccgtcggtctaccacccc
tacctgcagccccagggcgcgccggcggccgagagcaggtacctccgtacctggctagag
ccggctccccgcgccgaggccgccccggggcagggccaggcggccgtgaaggcggagccg
ctgctgggcgcgcccggggagctgcttaaacagggcacgcccgagtacagtttggaaact
tcggcgggcagggaggctgtcctgtctaatcaaagagccggctacggggacaataaaatt
tgcgaaggaagcgaggacaaagagaggccggatcaaaccaacccctctgccaactggctg
cacgcccgctcttcccggaaaaagcgctgtccctacaccaaataccagacgctggagcta
gagaaggagtttctattcaatatgtacctcaccagggaccgcaggcacgaagtggccaga
ctcctcaatctgagtgagagacaagtcaaaatctggtttcagaaccggcggatgaaaatg
aagaagatgaataaggagcagggcaaagagtaa

DBGET integrated database retrieval system