KEGG   Rattus norvegicus (rat): 287673Help
Entry
287673            CDS       T01003                                 

Gene name
Ccr7
Definition
(RefSeq) C-C motif chemokine receptor 7
  KO
K04182  C-C chemokine receptor type 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287673 (Ccr7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    287673 (Ccr7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    287673 (Ccr7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    287673 (Ccr7)
   04050 Cytokine receptors [BR:rno04050]
    287673 (Ccr7)
   04090 CD molecules [BR:rno04090]
    287673 (Ccr7)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    287673 (Ccr7)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   287673 (Ccr7)
CD molecules [BR:rno04090]
 Proteins
  287673 (Ccr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Motif
Other DBs
NCBI-GeneID: 287673
NCBI-ProteinID: NP_955783
RGD: 735151
Ensembl: ENSRNOG00000010665
UniProt: Q6U2D6
Position
10q31
AA seq 378 aa AA seqDB search
MDLGKPTKNVLVVALLVIFQVCFCQDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWF
LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAK
SWIFGAYLCKSIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCI
GIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEALIAIQVAQMVVGFVLPMLAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSSCEA
SKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDLFKLFKDLGCLSQERLRQWSSCRH
VRHTSVSMEAETTTTFSP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacctggggaagcccacgaaaaacgtgctggtggtggctctcctggtcattttccag
gtgtgcttctgccaagatgaggtcacagacgactacatcggcgagaacaccaccgtggac
tacaccctgtatgagtcggtgtgcttcaagaaggatgtgcggaactttaaggcctggttc
ctccctctcatgtactcagtcatttgcttcgtgggcctgctaggcaatgggctggtggtg
ctgacatacatctatttcaagagactgaagaccatgacggatacctacctgctcaacctg
gccgtggcagacatcctcttcctcatgatccttcccttctgggcctacagcgaagccaag
tcctggatctttggtgcctacctgtgtaagagcatctttggcatctacaagttaagcttc
ttcagcgggatgttgctgctcctgtgtatcagcattgaccgctatgtggccatcgtccag
gccgtgtcagcccaccggcaccgcgcccgcgtgcttctcatcagcaagctgtcctgtata
ggcatctggacgctggcctttttcctttctatccctgagctgctctacagcggcctccag
aagaacagcggcgaggacacgtggagatgctccctggtcagtgcccaagtggaggccttg
atcgccatccaagtggcccagatggttgttgggtttgtactgcctatgctggctatgagt
ttctgctacctggttatcatccgcactctgctccaggcgcgaaacttcgagcggaacaag
gccatcaaggtgatcatcgctgtggtcgtagtgttcgtcgtcttccagctgccctacaat
ggggtggtcctggcccagaccgtggccaatttcaacatcaccaatagcagctgcgaagcc
agcaagcagctcaacattgcctatgacgtcacctacagcctggcctccgtccgctgctgt
gtcaaccctttcttgtatgccttcatcggcgtcaagttccgcagcgacctcttcaagctc
ttcaaggacttgggctgcctcagccaggaacggctccggcagtggtcttcctgccgccat
gtacggcacacgtccgtgagcatggaggcggagactaccaccaccttctccccgtag

DBGET integrated database retrieval system