KEGG   Rattus norvegicus (rat): 287698Help
Entry
287698            CDS       T01003                                 

Gene name
Krt36, Ka31, Krt1-5
Definition
(RefSeq) keratin 36
  KO
K07604  type I keratin, acidic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    287698 (Krt36)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    287698 (Krt36)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    287698 (Krt36)
   04147 Exosome [BR:rno04147]
    287698 (Krt36)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     287698 (Krt36)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   287698 (Krt36)
  Exosomal proteins of other body fluids (saliva and urine)
   287698 (Krt36)
  Exosomal proteins of colorectal cancer cells
   287698 (Krt36)
  Exosomal proteins of melanoma cells
   287698 (Krt36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament TPR_MLP1_2 T6SS_VipA Lzipper-MIP1
Motif
Other DBs
NCBI-GeneID: 287698
NCBI-ProteinID: NP_001008759
RGD: 1305792
Ensembl: ENSRNOG00000031805
Vega: OTTRNOG00000000228
UniProt: Q6IFV5
Position
10q31
AA seq 468 aa AA seqDB search
MAQICTPTFSAGSAKGLCGTTGSFSRISSIHSMGSCRAPSLVGTVGSVSSFRTGFSGLGS
CLPGSYLSSSGFAGSGGWFCEGAFNGNEKATMQVLNDRLANYLEKVRQLEQENAQLECRI
REWYESQIPYICPDYQSYFKTAEDLQQKILLTKSENARLILQIDNAKLAADDFRTKYETE
LSLRQMVEADINGLRRILDELTLCKADLEAQVESLKEELLCLKRNHEEEVNALRSQLGDR
LNVEVDAAPPVDLNKILDDMRCQYETLVENNRRDVEAWFNTQTEELNQQVVSSSEQLQCC
QTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYSSQLGQMQCLITNVESQLAEI
RCDLERQNHEYQVLLDVKARLESEIATYRRLLEGEDCKLPAHPCSTDCKPPVRVPFVPST
SCTPAVPCTPAGPCTPASQVSTQIRTITEEIRDGRVISSREHVVPRAV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatctgcactccgactttctctgctgggtctgctaagggcctctgtggcacc
acaggaagcttctctcggatatcttccatccactccatgggctcctgcagggctcccagc
ttggttggcactgtggggtccgtgtcctccttcaggacaggcttctctggccttgggagc
tgcttgccgggctcctacctgtcctcttctggctttgctgggagcgggggctggttctgc
gagggcgccttcaatggcaacgagaaggccaccatgcaggtcttgaatgaccgactggcc
aactacctggagaaggtgcggcagctggagcaggagaacgcgcagctggagtgccgcatc
cgagagtggtatgagtctcagatcccatacatctgcccggactaccagtcctacttcaag
accgctgaggatttgcagcagaagatcctgttgaccaagtctgagaatgccaggctgata
ttacaaattgacaacgccaagctggctgcagatgacttcaggaccaagtatgagacggag
ttgtccctgaggcagatggtggaggctgacatcaatggtctgcgccggatcttggatgag
ctgaccttgtgtaaggctgacctggaggctcaggtggagtccctgaaggaggagctgctg
tgtctcaagaggaaccacgaagaggaagtcaatgcactccgttcccagcttggggataga
ctgaatgtggaagtggatgctgctcctcccgtggatctcaacaagatactggatgacatg
cgatgccagtatgagaccctggtggaaaataaccgtagagatgtggaggcttggttcaac
actcagactgaggagttgaaccagcaggtggtgtccagctcggagcagctgcagtgctgc
cagacggagatcattgagctgagacgcacagtcaacgccctggagatcgagctgcaggct
caacatagcatgaggaattctctggaatctaccttggctgagacagaggctcgctatagc
tcccagctgggccagatgcagtgcctgatcacaaacgtggagtcccagctggctgagatt
cgttgtgacctggaacggcagaaccatgaatatcaggtgttactggatgttaaggcccgg
cttgagtcagagattgctacctaccgccgcctgctggagggcgaggactgcaagcttcct
gcccacccttgttccaccgattgcaagcctcctgtaagagttcctttcgtcccttctaca
tcctgcaccccggctgtaccctgcaccccagctgggccctgcaccccagcttctcaagtc
agcacccagatccgcaccatcactgaggagatcagggatggaagagtgatctcctccagg
gagcacgtggtgccccgtgcagtgtga

DBGET integrated database retrieval system