KEGG   Rattus norvegicus (rat): 287701
Entry
287701            CDS       T01003                                 

Gene name
Krt14, Ka14, Krt1-14
Definition
(RefSeq) keratin 14
  KO
K07604  type I keratin, acidic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    287701 (Krt14)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    287701 (Krt14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    287701 (Krt14)
   04147 Exosome [BR:rno04147]
    287701 (Krt14)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     287701 (Krt14)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   287701 (Krt14)
  Exosomal proteins of other body fluids (saliva and urine)
   287701 (Krt14)
  Exosomal proteins of colorectal cancer cells
   287701 (Krt14)
  Exosomal proteins of melanoma cells
   287701 (Krt14)
SSDB
Motif
Pfam: Filament FlxA TPR_5 Filament_head DUF4600 DUF885 Bacillus_HBL
Other DBs
NCBI-GeneID: 287701
NCBI-ProteinID: NP_001008751
RGD: 1307463
Ensembl: ENSRNOG00000003899
Vega: OTTRNOG00000000214
UniProt: Q6IFV1
Position
10q31
AA seq 485 aa
MATCSRQFTSSSSMKGSCGIGGGSSRMSSVLAGGSCRAPSTYGGMSRFSSAGAYAVGSGY
GGGFSSSSFGGGFGGGIGGGIGGGLGGGIGGGFGGGIGGGFGGGIGSGFGGGLGDGLLVG
SEKVTMQNLNDRLATYLDKVRALEEANSDLEVKIRDWYQRQRPTEIKDYSPYFKTIEDLK
SKILAATVDNANVLLQIDNARLAADDFRTKFETEQSLRINVESDINGLRRVLDELTLARA
DLEMQIESLKEELAYLKKNHEEEMASMRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEK
MAEKNRKDAEDWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKA
SLENNLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIA
TYRRLLEGEDAHLSSAQFSSSSQFSSGSQSSRDVTSTNRQIRTKVMDVHDGKVVSTHEQV
LRTKN
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggccacctgcagccgtcagttcacctcctccagctccatgaagggctcctgtggcatc
ggtggtggctctagccgcatgtcctccgtcctggctggaggatcctgccgggctcccagc
acctacgggggcatgtctcgtttctcctctgcgggagcctatgcggttggaagtggctat
ggtgggggcttcagcagcagcagttttggtggtggatttggtggaggaattggtggtggt
attggtggaggacttggtggtggtattggtggtggatttggtggtggtattggtggtgga
tttggtggtggtattggtagtggatttggtggtggtcttggcgatgggctcctggttggc
agtgagaaagtgaccatgcagaacctcaatgaccgcttggccacctacctggataaggtg
cgtgccctggaagaggccaacagtgacctggaggtgaagatccgtgactggtaccagagg
cagcgccccactgagatcaaagactacagcccctacttcaagaccatcgaggacctgaag
agcaagatcctggcagccactgtggacaatgccaatgtcctcctgcagattgacaatgcc
cgcctggcggctgatgacttccgtaccaagtttgagacagagcagagcctgcgcataaat
gtggagtctgacatcaatggcctacgccgggtgctggatgagctgaccctggccagagct
gacctggagatgcagattgagagcctcaaggaagagctggcctacctgaagaagaaccac
gaggaggaaatggcttccatgagaggccaggtgggcggggacgtcaacgtggagatggat
gcggcccctggtgtggacctgagccgcatcctgaacgagatgcgggatcagtatgagaag
atggcagagaagaaccgcaaggatgccgaagattggttcttcaccaagacagaggagctg
aaccgcgaggtggccaccaacagcgaactggtgcagagcggcaagagcgagatctccgag
ctccggcgcacgatgcagaacctggagatcgagctgcagtcccagctcagcatgaaagca
tccctggagaataacctggaggagaccaaaggccgttactgcatgcagctggcccagatc
caggagatgatcggcagcgtggaggagcagctggctcagctgcgctgcgagatggagcag
cagaatcaggagtacaagatcctgctggatgtgaagactcggctggagcaggagatcgcc
acctaccgccgtctgctggagggcgaggatgctcacctttcatctgcccaattctcctca
tcgtctcaattctcctctggctctcaatcatccagagatgtgacctccaccaaccgccag
atccgcaccaaggtcatggatgtgcacgatggcaaggtggtctccacccacgagcaggtc
ctgcgcaccaagaactaa

DBGET integrated database retrieval system