KEGG   Rattus norvegicus (rat): 287709
Entry
287709            CDS       T01003                                 

Gene name
Rab5c
Definition
(RefSeq) RAB5C, member RAS oncogene family
  KO
K07889  Ras-related protein Rab-5C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05132  Salmonella infection
rno05146  Amoebiasis
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    287709 (Rab5c)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    287709 (Rab5c)
   04145 Phagosome
    287709 (Rab5c)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    287709 (Rab5c)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    287709 (Rab5c)
   05152 Tuberculosis
    287709 (Rab5c)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    287709 (Rab5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287709 (Rab5c)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    287709 (Rab5c)
   04031 GTP-binding proteins [BR:rno04031]
    287709 (Rab5c)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    287709 (Rab5c)
 Endosome - Lysosome transport
    287709 (Rab5c)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   287709 (Rab5c)
  Exosomal proteins of other body fluids (saliva and urine)
   287709 (Rab5c)
  Exosomal proteins of colorectal cancer cells
   287709 (Rab5c)
  Exosomal proteins of bladder cancer cells
   287709 (Rab5c)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    287709 (Rab5c)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 287709
NCBI-ProteinID: NP_001099310
RGD: 1307095
Ensembl: ENSRNOG00000018568
UniProt: B0BNK1
Position
10q31
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNAAGAPGRNRGVDLQESNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcgaggaggtgcagcacgacccaatggaccagctgcaggcaacaagatctgt
cagtttaagctggtcctcttgggcgagtctgcagtgggcaaatccagcctggtcctccgc
tttgtcaaggggcagttccatgagtaccaggagagcacaattggagcggctttcctcaca
cagactgtctgcttagacgacacaacggtcaagtttgagatctgggacacagctgggcaa
gagcgatatcacagcctggccccgatgtactatcggggggcccaagcagccattgtggtc
tatgacatcaccaacacagatacatttgcacgggctaagaactgggtgaaggagttacag
aggcaggccagccccaacatcgtcattgcactagcgggtaacaaagcagacctggccagc
aagagagccgtggagtttcaggaagcacaagcctacgcagatgacaacagtttgctgttc
atggagacgtccgcaaagactgcaatgaacgtgaatgaaattttcatggcgatagctaag
aagcttcccaagaatgagccccagaatgcagctggtgctccaggccgaaacagaggtgtg
gatctgcaggagagcaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system