KEGG   Rattus norvegicus (rat): 287711
Entry
287711            CDS       T01003                                 

Gene name
Coasy
Definition
(RefSeq) Coenzyme A synthase
  KO
K02318  phosphopantetheine adenylyltransferase / dephospho-CoA kinase [EC:2.7.7.3 2.7.1.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00770  Pantothenate and CoA biosynthesis
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    287711 (Coasy)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    287711 (Coasy)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     287711 (Coasy)
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     287711 (Coasy)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    287711 (Coasy)
SSDB
Motif
Pfam: CoaE CTP_transf_like AAA_33 AAA_18 LRRFIP PRK APS_kinase ATP_bind_2 AAA_22
Other DBs
NCBI-GeneID: 287711
NCBI-ProteinID: NP_001006955
RGD: 1549767
Ensembl: ENSRNOG00000019918
UniProt: Q5XIA5
Position
10q31
AA seq 563 aa
MAVFRSGLLVLTTPLATLAARLPPILTSASHLVNHTLYVHLQPGMNLGGPAQPQPSPVQA
TFEVLDFITHLYTGADLHRHLDVRILLTNIQTKSTLIPVLSSVQNLAHPPEVVLTDFQTL
DGSQYNPVKQQLERYATSCYSCSPQLSSVLLYPDYGTGEMPLELPNALLPSTIRPASPVA
RSPRQPVRGYRRGAVGGTFDRLHNAHKVLLSVACVLAQEQLVVGVADKDLLKSKLLPELL
QPYSERVGHLNEFLVDIKPSLTFELIPLLDPYGPAGSDPTLEFLVVSEETYRGGMAVNRF
RLENGKEELALYQIQLLKDQSHKENEEEKVSSSSFRQRILGNLLQPPNERPELPSGIYVL
GLTGISGSGKSSVAQRLKNLGAYIIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHQDGTI
NRKVLGSRVFGNKKQLKMLTDIVWPVIAKLAREEMDVAVAKGKTLCVIDAAMLLEAGWQN
MVHEVWTVVIPESEAVRRIVERDGLSEAAAQSRLQNQMSGQQLVEQSHVVLCTLWESHVT
QRQVEKAWDLLQKRLPKAHQTRN
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggccgtattccgctcaggcctcctggtgctgacaacgccgctggccaccctggccgca
cgcctgcctcccatcctgacctcggcgtcacacctggtgaatcacaccctctatgtgcac
ctgcagccgggcatgaacctggggggacccgctcagccccagcccagccctgtgcaggcc
acatttgaggttctggatttcatcacgcacctctacactggtgccgacctgcacaggcac
ctggacgtcagaattctactgaccaatatccaaaccaagagtaccttaatccctgtgctt
tcctcagtccagaatctggcccaccctccagaagtagttctgacggacttccagaccctg
gatgggagccagtacaaccctgttaaacaacagctagagcgttatgccaccagctgctac
agctgttctccacagttgtcttccgtattgctgtatccggattatgggactggagagatg
cctttggaactcccgaatgccctcttaccctccaccataaggccagcttccccggtggcc
agatctccgaggcagcctgtgcgtggctaccgccgtggggccgtgggtggcacttttgac
cgcttgcacaatgcccacaaagtgttgctcagtgttgcatgtgtactggcccaggagcag
cttgtggtgggagtagcggacaaagatctgttgaagagcaagttgctccctgagctgctc
cagccttattcagagcgtgtggggcatctgaatgagttcctggtggacatcaagccctcc
ctgacttttgaactcatccccctgctggatccctatgggcctgctgggtctgaccccact
ttggagttcctggtggtcagcgaggagacctaccgtggggggatggccgtcaaccgcttc
cgccttgagaatggcaaagaggagctcgccttataccagatacagctgctgaaggaccag
agtcacaaggaaaacgaggaggaaaaggtcagctcctccagctttcgccagcgaattctg
ggaaacctgcttcagcctccgaatgagaggcccgagctcccgtcaggtatctatgtgctg
gggctgacaggcatcagcggctctgggaaaagctcagtggctcagcggctgaagaacttg
ggggcatacatcattgacagtgaccatctgggccaccgggcctatgctcccgggggccct
gcctaccagcctgtggtggaggcctttggaacagatattctccatcaagatgggaccatc
aataggaaggtcctaggcagccgggtgtttgggaataagaagcagctgaagatgctcaca
gatattgtgtggccagttatcgcaaagctggcccgagaggagatggatgtggctgtggct
aagggaaagactctgtgtgtgattgatgctgctatgctgcttgaagctggctggcagaat
atggtacacgaggtgtggaccgtcgtcatccctgagtctgaggctgtacgtcgcattgtt
gagagggatggactgagtgaggcagccgctcaaagccggctgcagaaccagatgagtggg
cagcagctggtagagcagagccacgtggttctgtgcaccttgtgggaatcacatgtcaca
cagcgccaggtggaaaaggcttgggatcttctacagaaacgcctccccaaggctcaccag
accaggaactga

DBGET integrated database retrieval system