KEGG   Rattus norvegicus (rat): 287716
Entry
287716            CDS       T01003                                 

Gene name
Psme3
Definition
(RefSeq) proteasome activator complex subunit 3
  KO
K06698  proteasome activator subunit 3 (PA28 gamma)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno04612  Antigen processing and presentation
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    287716 (Psme3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    287716 (Psme3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    287716 (Psme3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    287716 (Psme3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    287716 (Psme3)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    287716 (Psme3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   287716 (Psme3)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 287716
NCBI-ProteinID: NP_001011894
RGD: 1306996
Ensembl: ENSRNOG00000051344
Vega: OTTRNOG00000000810
UniProt: Q5FVM2
Position
10
AA seq 254 aa
MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS
DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIE
KVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS
RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIE
KIKRPRSSNAETLY
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcctcgttgctgaaggtggatcaggaagtgaagctcaaggttgattctttcagggag
cggatcacaagtgaggcagaagacttggtggcaaattttttcccaaagaagttattagaa
cttgatagttttttgaaggaaccaattctaaatatccatgacctaactcagatccactca
gacatgaatctcccagtccctgaccccattctcctcaccaatagccacgatggactggat
ggtcccacttacaagaagcgcaggttggatgaatgtgaagaggccttccaaggaaccaag
gtgtttgtgatgcccaacgggatgttgaaaagcaaccagcagcttgtggacattattgag
aaagtaaaacctgagattcggctgctgatcgagaaatgtaacacggtcaaaatgtgggtt
cagctcttgattcccaggatagaagatgggaacaacttcggggtgtcgattcaggaggaa
acagttgcagagctaagaactgtcgagagtgaagctgcgtcttatctggaccagatttct
agatattatattacaagagccaaattggtttctaaaatagctaaatacccccatgtggag
gactatcgccgcactgtcacagagatcgatgagaaagagtacatcagcctccgcctcatc
atctcagagctgaggaatcagtatgtcacgctccatgacatgatcctgaaaaacattgag
aagatcaaacggccccgaagcagcaatgcagagacactgtactga

KEGG   Rattus norvegicus (rat): 29614
Entry
29614             CDS       T01003                                 

Gene name
Psme2
Definition
(RefSeq) proteasome activator complex subunit 2
  KO
K06697  proteasome activator subunit 2 (PA28 beta)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29614 (Psme2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    29614 (Psme2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29614 (Psme2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    29614 (Psme2)
SSDB
Motif
Pfam: PA28_beta PA28_alpha Lipase_chap
Other DBs
NCBI-GeneID: 29614
NCBI-ProteinID: NP_058953
RGD: 3430
Ensembl: ENSRNOG00000019246
UniProt: Q63798
Position
15
AA seq 238 aa
MAKPCGVRLSGEARKQVDAFRQNLFQEAEDFLCTFLPRKIISLSQLLQEDSLNVADLSSL
RAPLDIPIPDPPPKDDEMETEQEKKEVPKCGFLPGNEKLLALLALVKPEVWTLKEKCILV
ITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTAISKYFSERGDAVAKASKD
THVMDYRALVHERDEAAYGALRAMVLDLRAFYAELHHIISSNLEKIVNPKGEEKPSMY
NT seq 717 nt   +upstreamnt  +downstreamnt
atggccaagccttgtggggttcgcttgagtggagaagcccgtaaacaggtggatgccttc
agacaaaatcttttccaggaggctgaggacttcctttgcactttcttgccacggaaaatc
atatccctgagtcagctcttgcaagaggattccctcaatgtggctgacctctcctccctc
cgggctcctctggacatccctatcccagatcccccacccaaggatgatgagatggaaacc
gagcaggagaagaaagaagtccctaagtgtggcttcctccctgggaatgagaagcttctg
gccctgcttgccttggttaagccagaagtctggactctcaaagagaagtgcattctggta
atcacatggatccagcacctgatccccaagattgaggacggaaatgattttggggtggca
attcaggagaaggtgctggagagagtgaatgctgtcaagaccaaagtggaagccttccag
acagccatctccaagtatttctcagagcgtggggatgctgtagccaaggcctccaaggac
acccatgtaatggattaccgggccttggtgcacgagcgagatgaagcagcctatggggcg
cttagggccatggtgctggacctgagagccttctatgctgagcttcatcacatcatcagc
agcaacctagagaaaattgtcaacccaaagggtgaagaaaagccatctatgtactga

KEGG   Rattus norvegicus (rat): 29630
Entry
29630             CDS       T01003                                 

Gene name
Psme1
Definition
(RefSeq) proteasome activator complex subunit 1
  KO
K06696  proteasome activator subunit 1 (PA28 alpha)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29630 (Psme1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    29630 (Psme1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29630 (Psme1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    29630 (Psme1)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 29630
NCBI-ProteinID: NP_058960
RGD: 3429
Ensembl: ENSRNOG00000019041
UniProt: Q6P9V7
Position
15
AA seq 249 aa
MATLRVHPEAQAKVDVFREDLCSKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEEKDEKKKGDEDDKGPPCGPVNCNEKIVVLLQRLKPE
IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFQTQISKYFSE
RGDAVAKAAKQPHVGDYRQLVHELDEAEYQEIRLMVMEIRNAYAVLYDIILKNFEKLKKP
RGETKGMIY
NT seq 750 nt   +upstreamnt  +downstreamnt
atggctacactgagggtccatcctgaagcccaagccaaggtggatgtgtttcgtgaggac
ctgtgtagtaagacagagaacctgcttgggagctattttcccaagaagatctcagagttg
gatgccttcttaaaggagccagctctcaacgaagccaacctgagcaatctgaaggctcca
ttggacatcccagtccctgatcccgtcaaggagaaagagaaggaggagcggaagaagcaa
caggagaaggaagagaaggacgaaaagaagaaaggggacgaagacgacaaaggtcctccc
tgtggtccagtgaactgcaatgagaagattgtggtcctcctgcaacgcctaaagcccgag
atcaaggatgtcattgagcaactcaacctggttactacctggttgcagctacagatacct
cggatagaggatgggaataattttggcgtggctgtccaggaaaaggtgtttgagctgatg
accagccttcataccaagctggaaggcttccaaacgcagatctctaagtacttctccgag
aggggtgatgccgtggccaaagcagccaagcagcctcatgtgggtgattatcggcagctg
gtgcatgagctggacgaggcggaataccaggagatccggctgatggtcatggagatccgt
aacgcttatgctgtgttatatgacatcatcctgaagaactttgagaagctcaagaagccc
cgtggagagacaaaggggatgatctattga

DBGET integrated database retrieval system