KEGG   Rattus norvegicus (rat): 287734
Entry
287734            CDS       T01003                                 

Gene name
Atxn7l3, RGD1311493
Definition
(RefSeq) ataxin 7-like 3
  KO
K11363  SAGA-associated factor 11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    287734 (Atxn7l3)
   03036 Chromosome and associated proteins [BR:rno03036]
    287734 (Atxn7l3)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     287734 (Atxn7l3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     287734 (Atxn7l3)
    SLIK complex
     287734 (Atxn7l3)
SSDB
Motif
Pfam: Sgf11 SCA7 zf-C2HC_2 S_100 FXMRP1_C_core
Other DBs
NCBI-GeneID: 287734
NCBI-ProteinID: XP_002724614
RGD: 1311493
Ensembl: ENSRNOG00000020930
Position
10q32.1
AA seq 354 aa
MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKCGYFFLDDTDPDSMKD
FEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRI
ANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKLWYLPFQNPNSPRRSKSLKHK
NGKXXXSDPFKYSNSTGISYETLGPEELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQ
RRTVRIYFLGPSAVLPEVESSLDNDGFDMTDSQALLSRLQWDGSSDLSPSDSGSSKTSEN
QGWGLGTNSSESRKTKKKKSHLSLVGTASGLGSNKKKKPKPPAPPAPSIYEDIN
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaaaatggaggaaatgtctttgtctggcctggataacagcaaactagaggccatcgct
caggagatatatgctgacctggtcgaggattcttgtttgggattctgctttgaagtacac
cgggctgtcaagtgtggctacttcttcctggatgatacagatcctgatagcatgaaggat
tttgagatcgtggaccagcctgggttggacatctttggacaggttttcaaccagtggaag
agcaaggagtgcgtttgccccaactgcagccgcagtattgctgcctcccgctttgccccc
cacctggagaagtgcctgggaatgggccgcaacagcagccggatcgccaaccgtcggatt
gccaatagcaacaatatgaacaagtctgagagtgaccaagaagacaacgatgacatcaat
gacaatgactggtcctatggctcagagaagaaagccaagaagagaaaatcagacaagcta
tggtatctcccattccagaaccctaattcccctcgaagatccaagtctctaaaacacaaa
aatggtaagnnnnnnnnntccgatccttttaagtatagcaactcaactgggatcagctat
gagaccctggggccagaagagctgcggagcctgctcaccacacaatgtggagtaatttct
gaacataccaagaagatgtgcacaaggtcactacgctgcccgcagcacacggatgagcag
aggcgaaccgtgcggatttatttccttgggccctcggccgttcttccagaggtagagagc
tccttggacaatgatggctttgacatgactgacagccaggccctcctcagccggcttcag
tgggacggttcttctgatctctcaccgtctgattcaggctcctccaagactagtgaaaat
cagggatggggtttaggtaccaacagctctgaatcacggaaaaccaagaaaaagaaatcc
catctgagcttggtagggactgcctctggcctgggctccaacaagaagaaaaagccaaag
ccaccggctcccccagcgcccagcatctatgaggacatcaactga

DBGET integrated database retrieval system