KEGG   Rattus norvegicus (rat): 287747Help
Entry
287747            CDS       T01003                                 

Gene name
Spata32, RGD1359156, Tex34, Vad1.2
Definition
(RefSeq) spermatogenesis associated 32
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: VAD1-2 CLP_protease
Motif
Other DBs
NCBI-GeneID: 287747
NCBI-ProteinID: NP_001005531
RGD: 1359156
Ensembl: ENSRNOG00000003275
UniProt: Q66H17
Position
10q32.1
AA seq 348 aa AA seqDB search
MGVTGFSAFPCCGKNSVNIVERKNDDYHHHHHPLEDNKDEDNEMGTELSSMKPPPKVDPD
PVPHLEDMVTELTSTPIPETENPEQQNYRIESIKPYEEELTTTNTFKPRGFNVNSTNKEE
EEVVCGHFRSTPVQTSKHLFWSNKLIQASEHSLQTALEKHHKSPGEKKSISIAQVYTECT
QRPSSTQVSRTPTPTALGLADLINFASSLAVASSSNMALPNLGTMIKGTSEKAQNTSLDF
CQPIQSIKFTQATQITQISSEKQDEPPEVMAHKSWTQETRNVACSYLDINESGLKKATIQ
GEVKFVQAPATSPELQEDKDDSVPGTKKGTPILLKIHFKLSSPQAPEK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgacaggtttcagtgcatttccctgctgtggcaagaattcagtgaacattgtg
gaaagaaagaatgacgactaccaccaccaccaccaccccttagaagacaataaggatgaa
gacaatgagatgggaacagagttatcaagcatgaagcccccacccaaagtggacccagac
ccagtaccacatctggaggatatggtgacagagttaacctctacacccatacctgagact
gaaaacccggagcagcagaactacaggatcgaatccatcaagccctatgaggaggagctg
acaaccacaaacaccttcaagccccggggcttcaatgtgaactcaaccaacaaagaggag
gaggaggtggtgtgcggccactttcgctccacccctgtgcagacctccaagcaccttttc
tggtccaacaagctcatccaagcatcagagcacagcctacagacagccttagaaaaacat
cacaagagccccggggaaaagaagtctatctccatagcccaggtttacacagaatgtact
cagcggccgtccagcacccaggtgtctcgcacccccacgcccacagcccttggcttggca
gatctgatcaactttgcttcatccctggctgtagcctcctccagtaacatggccttgcct
aacctggggactatgatcaaaggaacatctgagaaggcccagaatacctccttagacttc
tgccagcccatccagtccatcaaatttacccaggctacccagatcacccagatatcctca
gagaagcaagatgaaccccctgaagtcatggctcacaaatcctggacacaggagaccagg
aatgttgcttgctcttacctggatattaacgagtcagggctcaagaaagccaccatccaa
ggggaagtgaagtttgtccaagcaccagctacatcccctgagcttcaggaagacaaagat
gactcggtgccgggaaccaagaaagggaccccaatattgctgaaaatccattttaagctg
tcatccccccaagccccagagaaatga

DBGET integrated database retrieval system