KEGG   Rattus norvegicus (rat): 287772
Entry
287772            CDS       T01003                                 

Gene name
Psmd12
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 12
  KO
K03035  26S proteasome regulatory subunit N5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    287772 (Psmd12)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    287772 (Psmd12)
   05012 Parkinson disease
    287772 (Psmd12)
   05014 Amyotrophic lateral sclerosis
    287772 (Psmd12)
   05016 Huntington disease
    287772 (Psmd12)
   05017 Spinocerebellar ataxia
    287772 (Psmd12)
   05020 Prion disease
    287772 (Psmd12)
   05022 Pathways of neurodegeneration - multiple diseases
    287772 (Psmd12)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    287772 (Psmd12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    287772 (Psmd12)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     287772 (Psmd12)
SSDB
Motif
Pfam: PCI RPN5_C Hydrophob_seed SIX1_SD
Other DBs
NCBI-GeneID: 287772
NCBI-ProteinID: NP_001005875
RGD: 1359305
Ensembl: ENSRNOG00000003117
UniProt: Q5XIC6
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
10q32.1
AA seq 456 aa
MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIETLLSLEKQTRTASDM
VSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPV
KLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKK
ERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSY
LSICKHYRAIYDTPCIQAESDKWQQALKSVVLYVILAPFDNEQSDLVHRISSDKKLEEIP
KYKDLLKLFTTMELMRWSTLVEDYGVELRKGSSETPATDVFSSTEEGEKRWKDLKNRVVE
HNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGVINFQRPKD
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcggacggcggctcggaacgggccgatgggcgcattgtgaagatggaggtggactac
agcgccacagtggaccagcgcctgcctgagtgcgagaagctggccaaggaaggacggctt
caggaagtcatcgaaacccttctctctctagaaaagcagacccggactgcctctgacatg
gtgtccacgtcccgcatcttggttgcagtagtgaaaatgtgctatgaggccaaagagtgg
gacttacttaatgaaaatattatgcttctgtcaaaacgaaggagtcagttaaaacaagca
gttgcaaaaatggtccagcagtgctgtacttatgtggaggagatcacagacctgccagtc
aagctgcggttgattgataccctgcgtatggttacagaaggaaagatttatgttgaaatt
gagcgtgccaggctgactaaaaccttagcaactataaaagagcaaaatggcgacgtgaag
gaggccgcctccatcctgcaggagttacaggtggaaacctatgggtctatggagaagaag
gagcgagtggagtttattctggagcagatgaggctctgcctagccgtgaaggattacatt
cgcacacagatcatcagcaaaaaaattaacaccaaattcttccaggaagaaaacacagag
aaattaaagttgaagtactataacttaatgattcagctggatcagcatgaggggtcctat
ctgtccatctgtaagcactacagagccatctacgacactccctgcattcaggcagaaagt
gacaagtggcagcaggctctgaagagtgttgttctctatgttatcctggctccttttgac
aatgagcagtcagatttggttcaccggataagtagtgacaagaagctggaagagattccc
aaatacaaggatctgctgaagctttttaccacaatggagctgatgcgctggtccacactt
gttgaggactatggggtggagctacggaagggctcctcggagaccccagcaactgacgtc
ttcagttctacagaagaaggtgaaaaacggtggaaagacttgaagaacagagtcgtggag
cataacatcagaattatggccaagtactacactcggataaccatgaaaaggatggcacaa
cttctggatctctctgtagatgagtcagaggccttcctctcgaatctagtcgttaacaag
accatctttgctaaagtggacaggttggctggggtcatcaacttccagagacccaaggat
ccaaataacttattaaatgactggtctcagaaactgaattcactgatgtctctggtgaac
aaaacgacacacctcatagccaaagaggagatgatacataatctacagtga

DBGET integrated database retrieval system