KEGG   Rattus norvegicus (rat): 287835
Entry
287835            CDS       T01003                                 

Gene name
Galk1, Galk, Glk
Definition
(RefSeq) galactokinase 1
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
Module
rno_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
rno_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    287835 (Galk1)
   00520 Amino sugar and nucleotide sugar metabolism
    287835 (Galk1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    287835 (Galk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     287835 (Galk1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   287835 (Galk1)
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 287835
NCBI-ProteinID: NP_001008283
RGD: 1305375
Ensembl: ENSRNOG00000006359
UniProt: Q5RKH2
Position
10q32.1
AA seq 392 aa
MAAWRPPRVEELLAEARRAFMEEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELV
TVMVGSPRTDGLVSLLTTSKDADEPQRLQFPLPSAQWSLEPGIPQWANYVKGVIQYYPAS
PLCGFSAVVVSSVPLGGGLSSSASLEVATYAFLQQLCPDSGSIAARAQVCQRAEHSFAGV
PCGIMDQLIALLGQKGYALLIDCRSLETSLVPLSDPKLTVLITNSNVRHSLASSEYPIRR
RQCEEVAQALGKESLREVRMEELEAGRELMSKEGFRRARHVVSEIRRTAQGAAALSRGDY
KAFGRLMVESHYSLRDDYEVSCPELDLLVEAALSVPGVYGSRMTGGGFGGCTVTLLEASV
APLVMHHIQEQYSGTATFYLTQAADGAQVLSL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggctgcttggagaccgccccgggttgaggagctgctggccgaggcccggcgggccttc
atggaggagtttggagccgagccggagctggcagtgtcggcgcctggccgcgtcaacctc
atcggggagcacacggattacaaccagggcctggtgctgcccatggctctggagcttgtg
acggtgatggttggcagcccccggacagatgggcttgtttctctcctcaccacttccaaa
gatgcagacgagccccagcgactgcagttcccactgccctcagcccagtggtccttggag
cctggaatcccacagtgggccaattatgtcaagggagtgattcagtattacccagcttcc
cctctctgtggcttcagcgcagtggtggtcagctcagtgcccctggggggtggtctttcc
agctcagcttctctggaagtggccacgtacgccttcctccagcagctctgcccagactcg
gggtcaatagccgctcgggcccaggtgtgtcaacgggctgagcacagcttcgcaggggtg
ccctgtggcatcatggaccaactcatcgcactgctggggcagaaaggctatgcgctactc
attgactgcaggtccctggaaacaagcctggtgccgctgtcagaccctaagctgaccgtg
ctcatcaccaactccaatgtccgccattccctggcctccagcgagtacccgattcgtcgg
cgccagtgtgaagaggtggcccaggccctgggcaaggagagccttcgggaggtgcggatg
gaggaacttgaggcgggcagggagctgatgagcaaggagggtttccggcgggcccggcac
gtggttagcgagatccggcgaacagcccagggagcagctgctctgagccgaggagactat
aaggcctttggacgtctcatggtggagagtcactattccctcagagatgactatgaggtg
agctgccctgagctggacctattggttgaggctgcgctctctgtgcctggagtttacggc
agtcgcatgacaggcggtggcttcggcggctgcactgtcacgttgctggaggcctctgtt
gccccccttgtcatgcatcacatacaggagcagtacagcgggacagccaccttctacctc
actcaagctgccgatggagcccaggtgctgagcttgtga

DBGET integrated database retrieval system