KEGG   Rattus norvegicus (rat): 287873Help
Entry
287873            CDS       T01003                                 

Gene name
Chmp6, RGD1565325
Definition
(RefSeq) charged multivesicular body protein 6
  KO
K12195  charged multivesicular body protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    287873 (Chmp6)
  09143 Cell growth and death
   04217 Necroptosis
    287873 (Chmp6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287873 (Chmp6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    287873 (Chmp6)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    287873 (Chmp6)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   287873 (Chmp6)
  Exosomal proteins of other body fluids (saliva and urine)
   287873 (Chmp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 Peptidase_S46
Motif
Other DBs
NCBI-GeneID: 287873
NCBI-ProteinID: NP_001099326
RGD: 1565325
Ensembl: ENSRNOG00000004014
UniProt: D3ZDR2
Position
10q32.3
AA seq 200 aa AA seqDB search
MGNLFGRKKQSRVTEQDRAILQLKQQRDKLRQYQKRVTQQLERERALARQLLRDGRKERA
KLLLKKKRYREQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQVGNECLNKMHQVMSI
EEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELNAITQEQIELPEVPSEPLPD
TSPEAPAKARSRQAELVAAS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacctgttcggtcgcaagaagcagagccgggtcactgaacaggacagggccatc
ctgcaactgaagcagcagagagacaagctgaggcagtaccagaagagggtcacgcagcag
ctggagagggaacgggctttggccaggcagctgcttcgggatggcaggaaagaacgggcc
aagctgctactcaagaagaagaggtaccgggagcaactgctcgataggacagaaaaccag
atcagcagcctggaagccatggttcagagcattgagttcacgcagatcgagatgaaggtg
atggaggggcttcaggtggggaacgaatgtctgaataagatgcaccaggtgatgtccata
gaggaggtggagaggatcctggacgagacccaggaggccgtggagtaccagcggcaaatt
gatgagctgctggcaggaagtttcacccaggaggacgaggatgccatcctggaagagctg
aatgcaatcactcaggaacaaatcgagttaccagaggttccttcggagcccctgcctgac
acaagcccagaagcccctgccaaggccagatccaggcaggcagagctggtggccgcttcg
taa

DBGET integrated database retrieval system