KEGG   Rattus norvegicus (rat): 287885
Entry
287885            CDS       T01003                                 

Gene name
Sectm1a, Sectm1
Definition
(RefSeq) secreted and transmembrane 1A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: V-set Ig_3 Herpes_gE DAG1
Other DBs
NCBI-GeneID: 287885
NCBI-ProteinID: NP_001013061
RGD: 1305973
Ensembl: ENSRNOG00000036672
UniProt: Q6AYS0
Position
10q32.3
AA seq 201 aa
MLTRPVVSTIPTLRLFSILLMVVSLNAQNKSWDRPICTENIVSVPRGRPAVMSCNISNTF
TDVTIQLTAHGKDRTIFKKKPQGNFSWSGWELHVQGGQAQLVIKDAQDDHRGIYLWQLHG
RQRYYRNITLNVSEPSNEDKVTDTRLFTSLPDQVKSSQLEAKPGTLMGVIIAVLALGVPG
ILALICYRHCRSQKPHWVRRF
NT seq 606 nt   +upstreamnt  +downstreamnt
atgctgacccgtcctgtggtgtccaccatccctactctcaggctgttcagcatcctcctc
atggttgtttccctgaatgctcagaataaaagctgggacagacctatctgcacggagaac
attgtgtctgtgcctagaggcaggcctgcagtgatgagctgtaacatctctaacaccttc
accgatgtcaccatccagctgactgcccatgggaaggacaggaccatcttcaagaaaaag
ccccaaggaaacttctcttggagtgggtgggagctccatgttcaaggggggcaggcacag
cttgtcatcaaagacgcccaggacgaccacagagggatatacttgtggcagctgcatgga
cgccagagatattacagaaacatcaccctgaatgtttcagagccttcaaatgaggacaag
gtcacagacacgaggctgttcacatccctcccagatcaagtcaagagctcccagctagag
gccaagcctgggacccttatgggagtcatcattgctgttttggccttgggagtcccagga
atccttgcacttatctgctacaggcactgccgttcccagaagccccattgggtaaggagg
ttctaa

DBGET integrated database retrieval system