KEGG   Rattus norvegicus (rat): 287910
Entry
287910            CDS       T01003                                 

Symbol
Ccl6
Name
(RefSeq) C-C motif chemokine 6 precursor
  KO
K05510  C-C motif chemokine 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287910 (Ccl6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    287910 (Ccl6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    287910 (Ccl6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    287910 (Ccl6)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   287910 (Ccl6)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 287910
NCBI-ProteinID: NP_001004202
RGD: 1303200
Ensembl: ENSRNOG00000030021
Vega: OTTRNOG00000000485
UniProt: Q68FP3
Position
10
AA seq 115 aa
MRHSKTAISFFILVAVLGSQAGLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCS
RFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA
NT seq 348 nt   +upstreamnt  +downstreamnt
atgagacattccaagactgccatttcattctttatccttgtggccgtccttgggtcccag
gctgggctcatacaagatacggtaaaagaagatcgtccctttaatcctacaataattcac
caaggctttcaagactcttcagactgctgcttctcctatgcctcacagatcccatgttca
agatttatatattattttccaaccagtggtgggtgcaccaagccaggcatcatctttgtc
accaggaagaggaagcgggtctgtgccaacccgagtgatcagagagttcagacgtgcata
agcaccctgaagctaggcccaagatctgggaacagtgccattgcttga

DBGET integrated database retrieval system