KEGG   Rattus norvegicus (rat): 287983
Entry
287983            CDS       T01003                                 

Gene name
Alg3
Definition
(RefSeq) ALG3, alpha-1,3- mannosyltransferase
  KO
K03845  alpha-1,3-mannosyltransferase [EC:2.4.1.258]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00513  Various types of N-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    287983 (Alg3)
   00513 Various types of N-glycan biosynthesis
    287983 (Alg3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    287983 (Alg3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.258  dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     287983 (Alg3)
Glycosyltransferases [BR:rno01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   287983 (Alg3)
SSDB
Motif
Pfam: ALG3 EpsG
Other DBs
NCBI-GeneID: 287983
NCBI-ProteinID: NP_001135835
RGD: 1306004
Ensembl: ENSRNOG00000001712
UniProt: Q5M7T0 F1M8K7
Position
11q23
AA seq 438 aa
MAAGLRKRGLPGSVVQPAGIWKQWLQRAWQERYLLLREPRYTLMVASCLCLAEVGITFWV
IHRVAYTEIDWKAYMAQVEGFINGTYDYTQLQGDTGPLVYPAGFLYIFTGLYYATDRGTD
IPTAQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMA
LLFLSVNLFLAQRWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLALCAA
LQVVLGLPFLLENPVGYLSRSFDLGRQFLYQWTVNWRLLPEAIFLHRAFHLALLAAHLSF
LLLFALCRWHRTGESILSLLKDPSKRKVPPQPLTPNQIVSVLFTSNFIGVCFSRSLHSQF
YVWYFHTLPHLLWATPARWLTHLLRLLVLGLIELSWNTYPSTPFSSAALHLCHAVTLLQL
WLSPQFFPRSVQPSRKTH
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggctgctgggctgcggaaacgcggcctgccgggttctgtcgtccagccggcaggaatc
tggaaacaatggctacagcgggcctggcaagaacgctatctactgctgcgggagcctcgc
tacaccttgatggtggcctcctgcctctgcctagcagaggtgggcatcaccttctgggtc
attcacagggtggcatacacagagattgactggaaggcctacatggcccaggtggagggt
ttcatcaatggcacatatgactacacacagctgcagggtgacaccggacctcttgtctac
ccagctggttttctgtacatctttacggggctttactatgctacggaccggggcactgac
atccctacggcccagaacatctttgctgtactctaccttgtcaccttggtgcttgttttc
ttgatataccaccagacctccaaggtgcctcccttcgtctttttcttcatgtgctgtgcc
tcttaccgtgtccactccatctttgtgctgcggctcttcaacgacccggtagctatggca
ttgctcttcctcagcgtcaacctcttcctggcgcagcgctggagctggggctgctgctgt
ttcagcctggccgtctcggtgaagatgaacgtgctccttttcgccccaggattgctattc
cttcttcttactcagttcggcttccgtggcgccctccccaagctggccctctgcgctgct
cttcaggtggtgctgggattgcccttcctgttagagaaccccgttggctacctgtcgcgc
tcctttgaccttggccgtcagtttctttaccaatggacagtgaattggcgtctcctgcct
gaagccatcttcctgcaccgtgccttccatctggccctgctggctgcccatcttagcttc
ctcttgctatttgccctctgtaggtggcacagaacaggggaaagtattctgtcgctgctg
aaggatccttccaaaaggaaagttccaccccaacccctcacacctaatcagattgtctcc
gtcctcttcacctccaacttcattggcgtctgcttcagccgctccctccactcccagttt
tatgtctggtacttccacacgctgccccacctcctgtgggccacgcccgcacgctggctc
acacacctgctcaggttgctggtgctgggactcatcgagctctcctggaatacataccca
tccacacccttcagctctgctgccctacacctgtgccacgctgtcaccctgctgcagctc
tggctgtcccctcagttctttcctaggagcgtccagccaagcaggaaaacccactga

DBGET integrated database retrieval system