KEGG   Rattus norvegicus (rat): 287986
Entry
287986            CDS       T01003                                 

Gene name
Eif4g1
Definition
(RefSeq) eukaryotic translation initiation factor 4 gamma, 1
  KO
K03260  translation initiation factor 4G
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    287986 (Eif4g1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    287986 (Eif4g1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    287986 (Eif4g1)
   03012 Translation factors [BR:rno03012]
    287986 (Eif4g1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     287986 (Eif4g1)
   mRNA cycle factors
    Stress granule specific factors
     287986 (Eif4g1)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    287986 (Eif4g1)
SSDB
Motif
Pfam: MIF4G MA3 W2
Other DBs
NCBI-GeneID: 287986
NCBI-ProteinID: XP_006221256
RGD: 1306144
Ensembl: ENSRNOG00000001738
UniProt: D4AD15
Position
11q23
AA seq 1592 aa
MNKAPQPTGPPPARSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQHFYPSRAQPPS
SAASRVQSAAPARPGPAPHVYPAGSQVMMIPSQISYSASQGAYYIPGQGRSTYVVPTQQY
PVQPGAPGFYPGASPTEFGTYAGAYYPAQSVQQFPASVAPAPVLMNQPPQIAPKRERKTI
RIRDPNQGGKDITEEIMSGARTASTPTPPQTGGSLEPQPNGESPQVAVIIRPDDRSQGAA
IGGRPGLPGPEHSPGTESQPSSPSPTPSPPPILEPGSESNLGVLSIPGDTMTTGMIPISV
EESTPISCESGEPYCLSPEPTLAEPILEVEVTLSKPIPESEFSSSPLQVSTSLVPHRAET
HEPNGVIPSEDLEPEVESSTEPAPPPLSACASESLVPIAPTAQPEELLNGAPSPPAVDLS
PVSEPEEQAKEVPSAALASIVSPTPPVAPSDTSAAQEEEIEEDEDEDGEAESEKGGEDLP
LDSTPVPAQLSQNLEVAAAPQVAVSVPKRRRKIKELNKKEAVGDLLDAFKEVDPAVPEVE
NQPPTGSNPSPESEGSAALPQPEEAEETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLN
LEEKKRYDREFLLGFQFIFASMQKPEGLPHITDVVLDKANKTPLRSLDPSRLPGINCGPD
FTPSFANLGRPTLSSRGPPRGGPGGELPRGPQAGLGPRRSQQGPRKETRKIISSVIMTED
IKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLMKQVT
QLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLL
NRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGE
LFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFAKAKPRMDQYFNQMEK
IIKEKKTSSRIRFMLQDVLDLRQSNWVPRRGDQGPKTIDQIHKEAEMEEHREHIKVQQLM
AKGGDKRRGGPPGPPVNRGLPLVDDGGWNTVPISKGSRPIDTSRLTKITKPGSIDSNNQL
FAPGGRLSWGKGSSGGSGAKPSDTASEATRPATLNRFSALQQTLPVENTDNRRVVQRSSL
SRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEERSRERPSQPEGLRK
AASLTEDRGRDPVKREATLPPVSPPKAALAVDEVERKSKAIIEEYLHLNDMKEAVQCVQE
LASPSLLFIFVRLGIESTLERSTIAREHMGRLLHQLLCAGHLSTAQYYQGLYETLELAED
MEIDIPHVWLYLAELITPILQEDGVPMGELFREITKPLRPMGKATSLLLEILGLLCKSMG
PKKVGMLWREAGLSWREFLAEGQDVGSFVAEKKVEYTLGEESEAPGQRALAFEELRRQLE
KLLKDGGSNQRVFDWIEANLNEQQIASNTLVRALMTTVCYSAIIFETPLRVDVQVLKVRA
RLLQKYLSDEQKELQALYALQALVVTLEQPANLLRMFFDALYDEDVVKEDAFYSWESSKD
PAEQQGKGVALKSVTAFFNWLREAEDEESDHN
NT seq 4779 nt   +upstreamnt  +downstreamnt
atgaacaaagctccccagcccacaggccccccacccgccaggtcccctggactcccacag
ccagcgtttcccccggggcagactgcaccggtggtgtttagcacgcctcaagcgacacaa
atgaacacgccttctcagccccgccagcacttctaccctagccgggcccagccccctagc
agtgcagcctcccgagtgcagagtgcagcccctgcccgtcctggcccagctccccatgtc
taccctgctggatcccaagtaatgatgatcccttcccagatctcctactcagcctcccaa
ggagcctactatatccctggacaggggcgttccacatatgttgtcccaacacagcagtac
cctgtgcagccaggagccccaggcttctatccaggtgcaagccctaccgagtttgggacc
tatgctggagcctattacccagcccagagtgtgcagcagtttcctgctagtgtggctcct
gccccagttctgatgaaccagccaccccagattgcccctaagagggaacggaaaactatc
cgaattcgagacccaaaccaaggagggaaggatatcacagaagagatcatgtctggggcc
cgtactgcctccacacccactcctccccagacgggaggcagtctggagcctcaacccaat
ggggagtcgcctcaggttgctgtcattatccggccagatgaccggtcacagggagcagcc
attggggggcggccagggctgcctggcccagagcacagccctggcacagagtctcagcct
tcgtcgccttctccaaccccatcaccacccccaattttggagccggggtctgagtctaat
cttggagtcctctctattcctggggacactatgacaacggggatgataccaatttctgta
gaagaatcgacccccatctcttgtgaatctggggagccatattgcctctctccagaaccc
actcttgccgaacccatactggaagtagaagtgacactcagcaaacccattccagaatct
gagttctcttccagtcctctccaggtttccacgtccctggtgcctcacagggctgaaact
catgagcccaatggcgtgatcccatctgaggatctggaaccagaggtggagtcaagcacg
gagccagctcctccccctctttcagcttgtgcttctgaatcgcttgtgcccattgctcca
actgcccaacccgaggagctgctcaatggagccccctcgccaccagctgtggacctcagc
cccgtcagtgagcccgaggagcaggccaaggaggttccctcagcggcactggccagcatt
gtctctcccactccacctgtggctccttctgatacttctgctgctcaggaggaagaaata
gaagaagatgaagatgaagatggagaagctgagagtgagaagggaggagaggacctccct
ctcgatagtactcctgtcccagcccaattgtctcagaatttagaggtggcagcagctccc
caagtggcagtgtctgtgccaaagaggagacggaaaattaaagagctaaacaagaaagag
gctgtgggtgaccttctcgatgccttcaaggaggtggacccagcagtaccagaggtggag
aatcagcctcctactggcagcaacccaagcccagagtctgagggcagtgctgcgctccca
cagcctgaggaagcagaggaaacctgggactctaaggaagacaaaattcacaatgccgag
aacattcagcctggggaacagaagtacgagtacaagtcagatcagtggaagcctctcaac
cttgaagagaagaagcgttatgatagggagttcctgctgggctttcagttcatctttgcc
agtatgcagaagccagaaggattgccccatatcactgatgtggtgctggacaaggctaat
aaaacaccacttcggtcactggatccctccagactacctggcataaactgtggcccagat
ttcactccatcctttgccaaccttggccgaccaaccctcagcagccgtgggcccccaagg
ggtgggccaggtggggagctgccccgagggccgcaggctggcctgggacccaggcgctct
cagcagggtccacggaaggaaactcgcaagatcatttcctcagtgataatgactgaagac
ataaaactgaacaaagcagagaaggcgtggaaacccagtagcaaacggacagccgctgat
aaggatcgaggggaggaggatgctgacggaagcaagacccaggacctgttccgaagggta
cgctccatcttgaataagctgacaccccagatgtttcagcagctgatgaagcaggtgaca
cagctggccattgacacggaggaacgcctcaaaggagtcattgacctcatcttcgagaaa
gccatttcagagcccaacttctctgtggcttatgccaacatgtgccgctgcctcatggcg
ctgaaagtgcccactacagaaaagccaacagtgactgtgaattttcgaaaactgttgtta
aatcggtgtcagaaagaatttgagaaagacaaagatgatgatgaagtttttgaaaaaaag
caaaaagaaatggatgaagctgctacggcagaagaacggggacgcctgaaagaagaacta
gaagaggcccgggacatagctcggcggcgctctttagggaatatcaagttcattggggag
ctattcaagttgaagatgttaacagaagcaataatgcatgactgtgtggtcaaactactt
aaaaaccatgatgaggagtccctagaatgcctctgccgtctcctcaccacgattggcaaa
gacctggactttgcaaaagccaagcctcgaatggatcagtatttcaaccagatggaaaaa
atcattaaagaaaagaagacctcatctcgcatccgttttatgctacaggatgtgcttgac
ctgcggcagagcaattgggtgccgcgtcgcggggatcagggccccaagacgatcgatcag
attcacaaggaggctgaaatggaggaacacagggagcacatcaaggtccagcagctcatg
gccaagggcggcgacaagcgtcggggcggccctccaggccctcctgtcaaccgtggcctt
ccacttgtggatgatggtggctggaatacagtccccatcagcaaaggcagtcgccccatt
gacacctcacggctcaccaagatcacaaagcctgggtccattgattctaacaaccagctc
tttgcacctggaggacgactgagttggggcaagggcagcagtgggggatcaggagccaaa
ccctcagacacagcatcggaagctactcgtccagctactttgaatcgcttttctgctctt
caacaaacattacccgtagagaacacagataacagacgtgttgtacagaggagcagctta
agccgggaacgaggtgagaaagctggggaccggggagaccggctagagcgcagtgagcgg
ggaggtgaccgtggggaccgacttgatcgtgccagaacacctgccaccaagcgaagtttt
agcaaagaagtggaggagcggagtagagagcggccatcccagcctgagggactccgcaag
gcagctagcctcacggaggatcgaggtcgggatcctgtgaagcgggaagccactctacct
ccagtgagccctccaaaggctgcgctcgctgtggatgaggtggagaggaagtcgaaggcc
atcattgaagagtatctccatctcaatgacatgaaggaggccgtgcagtgcgtccaggag
ctggcttcaccctccctgctcttcatctttgtacggcttggcatcgagtccacgctggag
cgaagcaccattgctcgtgagcacatggggagactgctgcaccagctactctgcgcaggg
cacctctctactgcccagtactaccaagggctgtatgaaacactagaattggctgaggac
atggaaatcgacatccctcatgtatggctttacctggcagaactgataacacctattctt
caggaagacggggtacccatgggagagctctttagggaaattacgaagcctctgagaccc
atgggcaaagccacttctttgttgctggagatcctgggtctcttatgcaagagcatgggt
cccaaaaaggtgggaatgctgtggcgagaggctgggctaagctggagggaatttctagca
gaaggccaagacgttggctcatttgtggctgaaaagaaggtggaatataccttgggagaa
gaatctgaagctcctggccagagggcacttgcctttgaggagctgcgaaggcagctcgag
aagctgctgaaggacggcggcagtaaccagcgtgtgtttgactggatagaggccaacctg
aatgagcagcagatagcatccaatacattagttcgagccctcatgacaactgtctgttat
tctgcaattatctttgagactcctctccgagtggatgttcaagtgttgaaagtgcgagca
agactgcttcagaaatacctgagtgatgagcagaaggagctacaagcactctatgctctc
caggcccttgtagtgaccttagaacagcctgccaacctgcttcggatgttctttgatgct
ctgtatgatgaggacgtggtgaaggaagacgccttctacagctgggagagcagcaaggac
cctgctgaacagcagggcaagggtgtggcccttaaatctgtcacagcattcttcaattgg
cttcgtgaggctgaggacgaggagtctgatcacaactga

DBGET integrated database retrieval system